KEGG   Rhodococcus erythropolis PR4: RER_23710Help
Entry
RER_23710         CDS       T00881                                 

Definition
hypothetical protein
Orthology
K16149  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rer00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2560534..2562102)
Genome map
AA seq 522 aa AA seqDB search
MSNATPVTEPGMFALVLHSHLPWLANHGRWPVGEEWIYQSWAASYIPLAAALRRLADEGR
SHLLTLGITPVLAAQLDDPHCLAGMHHWLGNWQIRAHEAAGMPDAAHRELGAREHRASAA
ALEDFETHWQHGASPVFRDLIDREAFELLGGPLAHPFQPLLDPRLRAFSLREGLADAHAR
WNHTPTGIWGPECGYTPGMERGYAEAGVTHFMVDGPALRGDTSLGRPVRESDVVAFGRDL
QVSYRVWSPKSGYPGHAAYRDFHTYDHETGLKPSRVTGRTVDSADKLPYNPELAAAAVDK
HVADFVETVRARLRSESARIGRDALVVAAFDTELFGHWWHEGPQWLEKLLRALPEAGIRV
GTLADAKESGYVGEPVQLEDSSWGSGKDWRVWAGDQVSDLVQLNSEVVDTALTTVDKSRG
RDNAPGRPELRNRVNDQVLRETLMTVSSDWAFMVSKDSAAGYARERAHKHAHATREISEA
LVSGRDAVAERLAEGWNRADGLFPGLDARRLPDTELVNGSAS
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaacgcaacacccgtcaccgaaccggggatgttcgccctggttctgcactcccat
ctgccgtggctcgccaaccacggcagatggcccgtcggcgaggaatggatctaccagtcc
tgggctgcgtcgtacattccgctcgccgccgcgctacgacgcctggccgacgagggccga
tcgcacctgctgacgctgggaatcacgccggtgctcgcggcccagttggacgatccccac
tgcctcgccggtatgcatcactggctcggcaactggcagatccgtgcacacgaggccgcc
ggcatgccggacgcagcgcaccgcgaactcggagcgcgcgaacaccgagcgtccgcagcg
gctctcgaagatttcgagactcattggcagcacggcgcctcacccgtgttccgcgacctc
atcgaccgcgaggccttcgagcttctcggcgggccgctggcccacccgttccagccgctg
ctcgaccctcgcttgcgtgcgttctccctccgcgaaggtctcgccgacgcgcatgcccgg
tggaatcacactccgaccgggatctggggacctgagtgcgggtacaccccgggcatggag
cgcgggtacgccgaagcgggcgtcacccacttcatggtcgacggccccgccttgcgcggc
gacacgtccctcggtcgcccggttcgagaatccgacgtggttgccttcggccgcgacctg
caggtcagctaccgcgtctggtccccgaaatccggatatccgggtcacgctgcttaccgc
gacttccacacctacgaccacgagacgggcctcaagccgtcgcgggtcaccggacggacc
gtcgactccgccgacaagttgccgtacaaccccgaactcgccgccgccgccgtcgacaag
catgtcgccgacttcgtcgaaaccgttcgggcgcgtctgcgcagtgaatccgcccgcatc
ggccgcgacgccctcgtggtcgcagcattcgacaccgaactgttcgggcactggtggcac
gaaggcccgcagtggctcgagaagctcctgcgcgcgcttccggaagccggaattcgcgtc
ggcaccctcgccgacgccaaggaatcgggatacgtgggcgaacccgttcagctcgaggat
tcgtcctggggatcgggcaaggactggcgcgtatgggccggcgatcaggtgtccgacctc
gtgcaactgaactccgaggtggtcgataccgccctcaccactgtggacaagtctcgcggc
cgcgacaacgcacccggccgaccggaactgcgaaaccgggtcaacgatcaggtccttcgc
gagacactgatgacagtttcgagcgattgggcattcatggtgagcaaggattcggccgcg
gggtacgcccgcgaacgcgcacacaagcacgcccacgcgaccagggaaatctccgaagcg
ctcgtttccggccgcgatgccgtggccgagcggctggccgaaggctggaatcgcgccgac
ggattgttcccggggctggatgctcgccgcctgcctgacacagaactggtgaacgggagc
gcgtcgtga

DBGET integrated database retrieval system