KEGG   Rhodococcus erythropolis PR4: RER_25520Help
Entry
RER_25520         CDS       T00881                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RER_25520 (dxr)
Enzymes [BR:rer01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     RER_25520 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2743111..2744301
Genome map
AA seq 396 aa AA seqDB search
MFSGVIRNNGRVQETTRTRVLLLGSTGSIGTQALEVIAANPDRFEVVGLAAGGNNVELLG
EQIRATGVTNVAVADPAAASALQSVTARSGPSAVTELVRDSGADVVLNALVGSLGLEPTL
AALNSGARLALANKESLVAGGALVTKAAAPGQIVPVDSEHSALAQCLRGGTGDEVARLVL
TASGGPFRGWSAEDLESVNPAQAKAHPTWSMGPMNTLNSATLVNKGLELIETNLLFGIDY
DRIDVTVHPQSIVHSMVTFFDGSTLAQASPPDMKLPIALALGWPDRIEGAASACDFTTAS
TWEFEPLDSSVFPAVDLARSAGKSGGCFTAIYNAANEVAAQAFLDGVISFPAIVRTVAAV
LDDAGQWSAEPVTVDDVLAADGWARTRARQLVKQEG
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
ttgttctcaggtgttatcaggaacaatgggcgagtgcaggaaaccacacgtacccgcgtc
ctcctcctcggcagtaccggttcgatcggtacccaagcgctggaggtcatcgcagccaac
cccgatcgtttcgaagtagtcggtctcgcagcgggcggcaacaacgtcgagttgttgggc
gaacagattcgtgcaaccggcgtcacgaacgtcgccgtcgccgatcctgcagcggcatcg
gcgctgcagtcggtaaccgcccgttcgggaccgagcgccgtgacggaactggttcgggac
agcggtgccgatgttgtcctcaatgcactcgtcggttcgttgggactcgaaccgactctg
gcggcgctgaactcgggagcgcgccttgcgctggcgaacaaggaatcgcttgtcgccggc
ggagcgctggtgaccaaagccgccgcacccggtcagatcgtgccggtcgactcggagcat
tcggcgcttgcccagtgtctacgtggtggaacaggcgacgaagtggctcggttggttctc
accgcttcgggtggaccgttccgtggctggagcgccgaggatctcgaaagtgtgaatcca
gctcaggcaaaagcgcaccccacctggtcgatggggcccatgaacaccctcaattcggca
actctggtcaacaagggcctcgagctgatcgagacgaacctgctgttcgggatcgactac
gaccgcatcgacgtcaccgtgcacccgcagtcgatcgtgcattccatggtcaccttcttc
gacgggtcgacgctggcgcaggcaagcccgccggacatgaagctcccgatcgctctcgct
ctaggctggccggaccgcatcgaaggtgctgcgtcggcatgcgacttcaccaccgcctcc
acctgggaattcgagccgctcgattcgtcggtgttccccgccgtcgatctggcgcgaagc
gcgggcaaatccggcggttgcttcaccgcgatctacaacgcggccaacgaagtggcggct
caggcattcctcgacggtgtcatttccttcccggcgatcgtccgcacggtggccgctgtt
ctcgacgatgcaggtcaatggtccgcggaaccggttaccgtggacgacgttctggccgca
gacggctgggcacgcacacgagcgcgtcagctcgtgaagcaggagggctag

DBGET integrated database retrieval system