KEGG   Rhodococcus erythropolis PR4: RER_25580Help
Entry
RER_25580         CDS       T00881                                 

Definition
putative fatty-acid--CoA ligase (EC:6.2.1.-)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:rer01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rer00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rer00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:rer00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:rer00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2750596..2752218
Genome map
AA seq 540 aa AA seqDB search
MSTDPTARVRELLDQYDTPHASAAELLCDRHPADGVAFTVVEADLSSVDLTYGHLREQSA
RFAAALADLGVEPGDNVATLMGKSADLVVALLGIWRRGAVHVPLFTAFASPAIAFRLTAS
GAKVVVSDANQLDKLAPGEDIPADAAWQVIVAGGAAGDELDFDALVAAQDAEDPKGAAQA
VGGNAPMVQLFTSGTTGTPKGVPVPVRALASFHAYQEFGLDVRQDDVFWNAADPGWAYGL
YYALLGPLAAGTRSILLHAGFSAPLTWQIIEKFGVTNFAAAPTVYRSLRADKAPVPEGIS
LRRASSAGEPLTPDVVAWSKNSLGVEVRDHYGQTEHGMFIVNAWADGLRGDVRPGSMGRP
LPGWSAAVLEDNSDDIAPARTQGRVAIDTHNSPLMWFTGYVDAPEKTKQRFSEDGRWYIT
GDAGMTDEDGFFFFSSRDDDVIIMAGYRIGPFDVESVLVMHEHVIEAAVVGMPDELRGEV
LEAFVVLREGVDGDDELEKELQTLVKKKFAAHAYPRTVHFVPNLPKTPSGKVQRYILRKG
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgatcccaccgcacgggtgcgcgagctgctggaccagtacgacaccccgcat
gccagcgccgcagaattgctctgcgatcggcatcccgcggatggcgttgcattcaccgtc
gtcgaggcagaccttagctcggtggacctcacttacggtcatctacgtgagcagtccgcg
cgtttcgcggcagctctggcggacctcggagtcgagccgggtgacaacgtcgcgaccttg
atgggcaagtctgcggacctcgtggtcgcgctcctcggaatctggcgccgcggcgcggtc
cacgtgcccttgttcacggcgttcgcttcgccggccatcgctttccgcttgacggccagt
ggcgcgaaggtggtcgtttccgacgccaatcagctcgacaagctcgcgccgggcgaggac
atccccgccgacgcagcgtggcaggtcatcgtcgcgggcggcgcggccggtgacgagttg
gacttcgatgcacttgtcgccgctcaggatgccgaagacccgaagggcgctgctcaggca
gtcggcggcaacgcaccgatggtgcagttgttcaccagtggcaccacggggacacccaag
ggcgtgccggttccggtgcgcgcgctcgcgtcgttccacgcctaccaggagttcggcctc
gacgtccgtcaggacgatgtgttctggaacgccgcagacccgggctgggcgtacgggctg
tactacgcgttgctcggtccgcttgccgcgggaacgcgaagcattctgctgcacgccgga
ttctccgcgccgctgacgtggcagatcatcgagaagttcggtgtcaccaattttgccgct
gctccgaccgtgtaccgcagtctgcgtgccgacaaggcacccgttccggaaggcatctcg
cttcgccgcgcgtcctcggccggtgagcccttgactccggatgttgttgcgtggtcgaag
aactcgttgggcgtcgaggttcgtgatcactacggccagaccgagcacggcatgttcatc
gtcaacgcctgggccgacggactccgcggggacgtccgtccaggatccatgggtcgtccg
ttgccgggctggtctgccgctgtgctggaggacaattcggatgacatcgcaccggctcgc
actcagggacgcgtggcgatcgatactcacaacagcccgttgatgtggttcaccgggtat
gtcgatgcgccggagaagacgaagcagcgattcagcgaagacggtcgctggtacatcacc
ggtgacgccggaatgacggacgaggacggattcttcttcttctcctcgcgcgacgacgac
gtcatcatcatggcgggctaccgcatcggtcccttcgacgtcgagagcgtgctggtcatg
cacgagcacgtcatcgaggcggcagtggtgggcatgcccgacgagttgcgcggtgaggtc
ctcgaagcgttcgtcgtacttcgcgaaggtgtcgacggtgacgacgaactcgagaaggaa
ctgcaaaccctggtgaagaagaagtttgcagcgcacgcgtacccacgcacggtgcacttt
gttccgaacctgcccaagaccccgagcggcaaggttcagcggtacatcttgcggaaggga
taa

DBGET integrated database retrieval system