KEGG   Rhodococcus erythropolis PR4: RER_25580Help
Entry
RER_25580         CDS       T00881                                 

Definition
putative fatty-acid--CoA ligase (EC:6.2.1.-)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RER_25580
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RER_25580
   00620 Pyruvate metabolism
    RER_25580
   00640 Propanoate metabolism
    RER_25580
  Energy metabolism
   00680 Methane metabolism
    RER_25580
Enzymes [BR:rer01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RER_25580
Lipid biosynthesis proteins [BR:rer01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RER_25580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2750596..2752218
Genome map
AA seq 540 aa AA seqDB search
MSTDPTARVRELLDQYDTPHASAAELLCDRHPADGVAFTVVEADLSSVDLTYGHLREQSA
RFAAALADLGVEPGDNVATLMGKSADLVVALLGIWRRGAVHVPLFTAFASPAIAFRLTAS
GAKVVVSDANQLDKLAPGEDIPADAAWQVIVAGGAAGDELDFDALVAAQDAEDPKGAAQA
VGGNAPMVQLFTSGTTGTPKGVPVPVRALASFHAYQEFGLDVRQDDVFWNAADPGWAYGL
YYALLGPLAAGTRSILLHAGFSAPLTWQIIEKFGVTNFAAAPTVYRSLRADKAPVPEGIS
LRRASSAGEPLTPDVVAWSKNSLGVEVRDHYGQTEHGMFIVNAWADGLRGDVRPGSMGRP
LPGWSAAVLEDNSDDIAPARTQGRVAIDTHNSPLMWFTGYVDAPEKTKQRFSEDGRWYIT
GDAGMTDEDGFFFFSSRDDDVIIMAGYRIGPFDVESVLVMHEHVIEAAVVGMPDELRGEV
LEAFVVLREGVDGDDELEKELQTLVKKKFAAHAYPRTVHFVPNLPKTPSGKVQRYILRKG
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgatcccaccgcacgggtgcgcgagctgctggaccagtacgacaccccgcat
gccagcgccgcagaattgctctgcgatcggcatcccgcggatggcgttgcattcaccgtc
gtcgaggcagaccttagctcggtggacctcacttacggtcatctacgtgagcagtccgcg
cgtttcgcggcagctctggcggacctcggagtcgagccgggtgacaacgtcgcgaccttg
atgggcaagtctgcggacctcgtggtcgcgctcctcggaatctggcgccgcggcgcggtc
cacgtgcccttgttcacggcgttcgcttcgccggccatcgctttccgcttgacggccagt
ggcgcgaaggtggtcgtttccgacgccaatcagctcgacaagctcgcgccgggcgaggac
atccccgccgacgcagcgtggcaggtcatcgtcgcgggcggcgcggccggtgacgagttg
gacttcgatgcacttgtcgccgctcaggatgccgaagacccgaagggcgctgctcaggca
gtcggcggcaacgcaccgatggtgcagttgttcaccagtggcaccacggggacacccaag
ggcgtgccggttccggtgcgcgcgctcgcgtcgttccacgcctaccaggagttcggcctc
gacgtccgtcaggacgatgtgttctggaacgccgcagacccgggctgggcgtacgggctg
tactacgcgttgctcggtccgcttgccgcgggaacgcgaagcattctgctgcacgccgga
ttctccgcgccgctgacgtggcagatcatcgagaagttcggtgtcaccaattttgccgct
gctccgaccgtgtaccgcagtctgcgtgccgacaaggcacccgttccggaaggcatctcg
cttcgccgcgcgtcctcggccggtgagcccttgactccggatgttgttgcgtggtcgaag
aactcgttgggcgtcgaggttcgtgatcactacggccagaccgagcacggcatgttcatc
gtcaacgcctgggccgacggactccgcggggacgtccgtccaggatccatgggtcgtccg
ttgccgggctggtctgccgctgtgctggaggacaattcggatgacatcgcaccggctcgc
actcagggacgcgtggcgatcgatactcacaacagcccgttgatgtggttcaccgggtat
gtcgatgcgccggagaagacgaagcagcgattcagcgaagacggtcgctggtacatcacc
ggtgacgccggaatgacggacgaggacggattcttcttcttctcctcgcgcgacgacgac
gtcatcatcatggcgggctaccgcatcggtcccttcgacgtcgagagcgtgctggtcatg
cacgagcacgtcatcgaggcggcagtggtgggcatgcccgacgagttgcgcggtgaggtc
ctcgaagcgttcgtcgtacttcgcgaaggtgtcgacggtgacgacgaactcgagaaggaa
ctgcaaaccctggtgaagaagaagtttgcagcgcacgcgtacccacgcacggtgcacttt
gttccgaacctgcccaagaccccgagcggcaaggttcagcggtacatcttgcggaaggga
taa

DBGET integrated database retrieval system