KEGG   Rhodococcus erythropolis PR4: RER_26060Help
Entry
RER_26060         CDS       T00881                                 

Definition
putative magnesium chelatase subunit
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rer00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2798597..2800537
Genome map
AA seq 646 aa AA seqDB search
MAGFPFSAVVGQDQLRLALILCAVHPGIGGVLVRGEKGTAKSTVVRALTALLPAVDDAGT
TRPARLVELPVGATEDRVIGSIDLEKVLRDGERAFQPGLLAAAHQGVLYVDEVNLLHDHL
VDVLLDAAAMGRVHIERDGISHSHPANFVLVGTMNPEEGELRPQLLDRFGLAVDVAASRD
VDVRMEVVRRRLDYERDPEAFVARYESADEELAAEILTAREKLDSVELSNRELRRIASLC
ASFDVDGMRADLVLARTATAHAAWRGDSEVTAEDVRVAAELTLPHRRRRDPFDEPGLDQQ
QLDDALEQADQDAQSQVEDDARDGEPEPPENPEDHGPDEDRGQEDGGPEDGGPEDEGPDD
DGPEDPDGPGGGVRATDRPSAPPAGEFKAKLLEVPGVGEGAPGRRSRSMSPRGRVVRSTR
ERGHGLHLTSTVFAAAESQVARGRTAGRLRLAPADLRGAIREGREGNLIVFVVDASGSMA
ARDRLSAVTGAVVSLLRDAYQRRDKVAVITVRGREAELVLPPTSSVDIAVRRLQSMRTGG
KSPLAEGFLRAREVVLRERLRDPQRRALVVTLTDGRATGGKDALHRARVAAYLLADASVA
SIVVDCETGLVRLGLAAELARELRGGYVRLAELSAQQVAGVVRAAA
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
gtggcgggcttcccgttcagtgctgtggtcggccaggatcaattgcggttggcgctgatt
ctgtgtgctgtgcatccggggatcggtggagtcctggtccgcggtgagaagggaactgcc
aagtcgacggtcgtgcgcgcgctgactgcgctgctgcccgcggtcgacgacgccggaacg
acacgaccggcccgcttggtggaactgcccgtcggcgccaccgaggaccgagtgatcggg
tccatcgacctcgagaaggttctccgcgacggtgagcgcgctttccaacctggactgctc
gccgccgctcaccagggagttctgtacgtcgacgaggtgaatctgcttcacgaccacctg
gtcgacgtgcttctcgacgccgcggcgatgggtcgcgttcacatcgagcgtgacggaatc
tcccattcgcacccggccaatttcgtactcgtcggcacgatgaatcccgaagagggagaa
ctgcgtccacagttgttggaccgtttcggactggcggtcgatgtcgcagcttcccgcgac
gtcgacgtacgcatggaagtcgtgcgtcgccggctcgactacgagcgcgaccccgaggcg
tttgtcgctcggtacgaatccgccgatgaggagctcgcggccgaaatcctcacggcgcgt
gagaaactggactcggtcgagctgagcaaccgcgagctgcgtcgtatcgcctcactgtgt
gcgtcgttcgacgtcgacggtatgcgcgcggacctggtgctggcgcgcaccgcgaccgcc
cacgctgcctggcgaggcgacagcgaggtcactgccgaggacgtgcgagtggctgcggaa
ctgacgctgccgcatcgccgccgccgcgatccgttcgacgagcccggcttggatcagcag
cagttggacgatgcactcgagcaggccgatcaggacgcccagtcgcaggtagaggacgac
gcgcgcgacggagagcccgaacctcccgagaatcccgaagaccatggccctgacgaagac
cgtggccaggaagatggtggccccgaagacggcggtcctgaagacgagggtccggacgac
gacggcccggaagaccctgacggacctggtgggggagtacgcgctaccgatcgcccctcg
gcgccaccggccggcgaattcaaggccaagctcctcgaggttcctggtgtcggcgaaggt
gcaccgggacgccgctcgcggtccatgtcgccgcgtggacgagtcgtgcggtccacgcgg
gaacgtggccacggattgcatctgacgagcacggtcttcgccgcagccgagtctcaagtt
gcccgtggtcgcactgctggacggctgcggctggcacctgctgatctccgcggcgcgatt
cgtgaagggcgagaaggcaatctgatcgtcttcgttgtcgacgcgtcgggatcgatggca
gcacgcgaccgcctctccgcggtcaccggtgcggttgtctcgttgctccgcgacgcctat
cagcgccgcgacaaggtcgcggtcatcactgtccgtggtcgtgaagcagagctcgtactg
ccgccgacctcttcggtggacatcgccgtccgtcgcctgcagtcgatgcggaccggcggc
aaatccccactcgcagagggattcctgcgtgctcgcgaagtggttctgcgtgaacggctt
cgtgacccgcagcgccgcgccctcgtcgtcacgctcaccgacggccgggctaccggcggc
aaggacgcgctgcaccgcgcccgcgtcgccgcgtatcttcttgccgacgcgtccgtcgct
tccatcgtcgtcgactgcgagaccggcctcgtgcgtctggggctggcagccgagttggcc
cgagaactacgtggcggttacgtccgccttgccgaattgtcagcgcagcaggtcgcgggt
gtcgtccgcgccgcagcctag

DBGET integrated database retrieval system