KEGG   Rhodococcus erythropolis PR4: RER_26460Help
Entry
RER_26460         CDS       T00881                                 

Definition
(GenBank) putative zinc-containing alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
rer00010  Glycolysis / Gluconeogenesis
rer00071  Fatty acid degradation
rer00350  Tyrosine metabolism
rer00625  Chloroalkane and chloroalkene degradation
rer00626  Naphthalene degradation
rer01100  Metabolic pathways
rer01110  Biosynthesis of secondary metabolites
rer01120  Microbial metabolism in diverse environments
rer01130  Biosynthesis of antibiotics
rer01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RER_26460
  Lipid metabolism
   00071 Fatty acid degradation
    RER_26460
  Amino acid metabolism
   00350 Tyrosine metabolism
    RER_26460
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RER_26460
   00626 Naphthalene degradation
    RER_26460
Enzymes [BR:rer01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RER_26460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C PALP AlaDh_PNT_C 2-Hacid_dh_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: BAH33354
NITE: RER_26460
UniProt: C0ZYB9
Position
2841674..2842780
Genome map
AA seq 368 aa AA seqDB search
MKIRGAVLEEIGRERPFAESTPISISELDLESPGPGEILVKIEAAGLCHSDLSVVDGNRV
RPVPMLLGHEAAGRIVELGDGVDSLSVGTRVVMTFLPRCGECAGCATDGRMPCTVGSAAN
NDGSLLGGAQRLRRSGESVKHHLGVSGFATHAVVNAKSVVAVEDDIPAEIAAVLGCAVLT
GGGALLNAAKPRPADTVMVVGLGGVGMAAILTARALGVENVIGVDALESKLAQALELGAT
EVFTPSGLSESGVRADIVVEAAGNARAFETAVAATAAGGTTVTVGLPATDARSSISPLGL
VAEARTIIGSYLGSAVPARDIPIYAQLWRDGKLPVEKLISSRIELDDINSGMDELADGKA
IRQVIIFD
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
ttgaagatccgtggtgcagtgctcgaagagatcggccgggagcgtccctttgcggagtcg
actccgatttcgatttcggaactcgacctcgaatccccgggcccgggtgagatcctcgtc
aagatcgaagctgccgggctttgtcactccgacctctccgtggtcgacgggaatcgcgtt
cgccccgtgccgatgttgctgggccacgaggcagctggtcgaatcgtcgaactcggcgac
ggcgttgattcgttgtcggtgggcacccgcgtcgtgatgacttttcttccgcggtgtggc
gagtgcgcgggatgcgccactgacggccggatgccgtgcacggtgggtagcgccgccaac
aacgacggcagtttgctcggtggcgcgcaacgactgcggcgctccggcgagagcgtcaaa
catcatctcggcgtttcgggtttcgcgacgcatgcggtggtcaacgccaagtccgtagtt
gccgtcgaagacgatattccggccgagattgcagccgtactcggttgcgcggtgttgacc
ggcgggggagcgctactcaacgcggccaagcctcgcccggcggacactgtgatggtggtc
ggcttgggcggcgtcgggatggccgcaatcctgacggcgcgggcactcggggtcgagaac
gtcatcggcgtcgacgcactggagtccaagctggctcaggcgctggaactgggcgcgacc
gaggtcttcacaccgtccggcctgtccgagagtggcgttcgcgcagacatcgtcgtcgaa
gctgcgggaaatgctcgggcgttcgagacagccgtggccgcgacggcagcgggtggcacg
accgtcacggtcgggttgcctgcgactgacgcgcgctcgtcgatctcgccgctcgggctg
gtggccgaagcgcggaccatcatcggcagttacctcggatccgcggtccccgcccgcgac
atcccgatctacgcgcaattgtggcgggacgggaagctaccggtcgagaagctcatctcc
tcgcgaatcgagttggacgacatcaattccggcatggacgaacttgcggacggaaaagca
atccgacaggtcattattttcgactga

DBGET integrated database retrieval system