KEGG   Rhodococcus erythropolis PR4: RER_28170Help
Entry
RER_28170         CDS       T00881                                 

Gene name
ppgK
Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
rer00010  Glycolysis / Gluconeogenesis
rer00520  Amino sugar and nucleotide sugar metabolism
rer01100  Metabolic pathways
rer01110  Biosynthesis of secondary metabolites
rer01120  Microbial metabolism in diverse environments
rer01130  Biosynthesis of antibiotics
rer01200  Carbon metabolism
Module
rer_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rer_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RER_28170 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    RER_28170 (ppgK)
Enzymes [BR:rer01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     RER_28170 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: BAH33525
NITE: RER_28170
UniProt: C0ZYU0
Position
complement(3024031..3024852)
Genome map
AA seq 273 aa AA seqDB search
MFATVDRDLEFDTQERRTMTTTGFGIDVGGSGVKGGTIDLSTGEMIGDRIKILTPQPSTP
DAIAGTVAEIVEQAKWTGPVGITLPAVVTGGVARSAANIDKSWIDTDAASLFGKALGGRE
VTVLNDADAAGIAEDSFGAGKDTSGVVILLTFGTGIGSAVLHNGVLLPNTEFGHLEVDGK
EAEHRAASSVKEKKDWSYKEWAVEVSRVLTTFENLLWPDLFIAGGGISRKHEKWIPHLTN
RTKVVPATLLNTAGIAGAALASVGLTRPAPVAG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgcaacggtagatcgtgacctcgaattcgacactcaggagcgcaggacgatgaca
accacaggtttcgggatcgacgtcggcggcagcggcgtcaagggcggcacgatcgacctg
agcaccggggaaatgatcggtgaccgcatcaagatcctgaccccgcagccgtccactccc
gatgcgatcgcgggcactgtggccgagatcgtcgagcaagcaaagtggaccgggccggtc
ggcatcacgttgcccgctgtcgtgaccggcggcgtcgcgcgcagcgccgcgaacatcgac
aagtcctggatcgacaccgacgcggcctcgctcttcggcaaggccctgggcgggcgcgaa
gtcaccgtcctcaacgacgccgacgccgccggaattgccgaggactcgttcggcgcgggc
aaggacacctccggcgtcgtgatcctcttgaccttcggcaccggaatcggatctgccgtg
ttgcacaacggagttctgttgcccaacaccgagttcggccacctcgaggtcgacggcaag
gaagccgagcatcgagcggcgtcgtcggtgaaggaaaaaaaggactggagctacaaggag
tgggcggtcgaggtctcccgagttctaaccaccttcgagaacctgctgtggcctgatctc
ttcatcgccggaggcggaatcagccgcaagcacgagaagtggattccgcacctgaccaac
cgcacgaaggtcgtccccgccaccctcctcaacaccgctggaatcgccggagctgcgctc
gcgtcggtcggactgaccaggccggcccccgtcgccggatga

DBGET integrated database retrieval system