KEGG   Rhodococcus erythropolis PR4: RER_28410Help
Entry
RER_28410         CDS       T00881                                 

Definition
(GenBank) putative oxidoreductase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
rer00984  Steroid degradation
rer01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    RER_28410
Enzymes [BR:rer01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     RER_28410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C Pyr_redox_2 DAO NAD_binding_8 FAD_binding_2 GMC_oxred_N FAD_binding_3 TAT_signal GIDA ApbA Pyr_redox UDPG_MGDP_dh_N Mqo
Motif
Other DBs
NCBI-ProteinID: BAH33549
NITE: RER_28410
UniProt: C0ZYW4
Position
3047658..3049229
Genome map
AA seq 523 aa AA seqDB search
MSGVKRRSFLAGTAAVGVAMMAPRTAKAATGIPLTREVHRVVVIGSGFGGGVTALRLAEA
GVPVTLLERGIRWQAGPNAETFPHPASPDKRILWHQSNPTLFGRPAIFEPYAGLLETVTG
ENMTAICAAGVGGGSLVYQGMTLQPEEAVFNTHFPEELDYARMDRVHYPRVARMLQVETA
PDELISSPNYEAARVFARNATRSGLPVSKIPMPIDWNYALAELRGEMKPSYTNGDGALGV
NNGGKHSVDVTYIAAAEATGLVNVETLHQVTDVERAADGRWRVYVDRTDISGKILENKIL
TTDALVMAAGSMNTTKLLVRAAATGRITDLPDELGAGWGTNADRIYIWSDLAENFGATQG
GPVVYGSRNWDDPHNAFTVIQASFPPVAFDAHSTVMVGFGVSSDRGRFVYDSARGEAVLR
WPRDGDSAIQQGHIGPAAQRIAAGGLLTDTNALLPSTWHPLGGACMNSVCDLDGRVLGQR
GLYVLDGALLPGNSAACNPSMTIAAVAERALVNIVKDDVGTLF
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgtccggagtgaaacgtagatcgttcttggccggtacggccgccgtgggagtcgcgatg
atggcgccacgcactgccaaggctgcaacagggattccgctgacacgtgaagtgcaccgt
gtcgtggttatcggttcggggttcggcggaggggtgacggcacttcgcttggccgaggcc
ggggttccggtcaccctgctggagagagggattcggtggcaggccgggccgaatgccgaa
acttttccgcatcccgccagtccggacaagcgtatcctctggcatcagtccaacccgact
ctgttcggcaggccggcgatcttcgagccgtacgcgggtttgttggagacggtgaccggt
gagaacatgaccgcgatctgcgcagccggggtgggcggcggatcgcttgtgtaccaaggg
atgacgctgcaaccggaagaagcggtcttcaacacgcactttccggaggagctcgattac
gcacgaatggaccgcgtccattacccgcgggtggcgcggatgttgcaagtggaaactgca
cccgacgaactgatttccagcccgaactacgaggcggcacgtgtattcgcgcgtaacgca
acgcgttccggtctacccgtgtcgaagattccgatgccgatcgactggaactacgcgttg
gccgaactgaggggtgagatgaagccgtcgtacaccaacggtgacggcgcgctcggtgtc
aacaacgggggcaagcattcggtggatgtcacctacattgcggcagcggaagcgaccgga
ttggtgaatgtggagactctgcaccaggtcaccgatgtcgagcgggcggccgacggacgg
tggcgtgtgtacgtggaccggaccgacatttccggcaagattctcgagaacaagattttg
acgacggatgcgctcgtgatggctgccggcagcatgaacaccaccaaactcctggtccgc
gccgcagcaacggggcggatcacggatttgcccgacgaactcggcgcgggatgggggacc
aatgccgaccggatctacatctggtcggatctcgcggagaatttcggtgcgacacagggc
gggccggtcgtctacggcagccggaactgggacgacccgcataacgcgttcaccgtcatt
caggcgtcgttcccgccggtggcgttcgacgctcacagcacggtgatggtcggattcggg
gtcagcagcgaccgaggtcggttcgtgtacgactcagcgcgaggcgaggcggtgctccgt
tggccgagggatggcgactctgcgatccagcaaggccacatcggacctgcggcccagcgg
atcgcggcaggaggactgctcaccgacaccaacgcgttactgccgtccacctggcatccc
ctcggcggtgcctgcatgaactcggtgtgcgatcttgatggtcgggttctgggccagcgg
gggttgtacgtgctcgacggcgctctgttgccggggaactccgctgcgtgcaatccgtcg
atgactatcgccgccgtcgcggagcgtgcgctcgtgaacatcgtgaaagacgatgtggga
accctattctga

DBGET integrated database retrieval system