KEGG   Rhodococcus erythropolis PR4: RER_29240Help
Entry
RER_29240         CDS       T00881                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rer00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RER_29240 (ruvA)
Enzymes [BR:rer01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     RER_29240 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
3133541..3134140
Genome map
AA seq 199 aa AA seqDB search
MIASVRGEVLDIALDHAVIEASGVGYRVNATPVTLGALHRGSEARLFTTMIVREDSMTLY
GFSDTESKDLFSLLQTVSGVGPRLAMATLAVLEPDALRRALSEGNLTALTRVPGIGKRGA
ERMVVELRDKVDAVATTAGAASGAVVGSSIRDQIVEALEGLGFPIKQAEQATDSVLAESP
EATTSVALRSALSLLGKTR
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgtcggtacgcggcgaggtactcgatattgcgctcgaccacgcggtcatcgaa
gcgtcaggtgtcggctatcgggtcaatgccaccccggtgactctcggtgcactgcatcgg
ggaagcgaagcgcgactgttcacgacgatgatcgttcgcgaagactcgatgacgctctac
ggtttttccgataccgagtcgaaggacctgttcagcctcttgcagacggtttccggagtc
ggaccgcgcctggcgatggcaactcttgcagtgctcgaaccggacgcattgcggcgggca
ctctcggaaggcaacctgacggcgttgacgagggtccccggtatcgggaaacgcggcgcc
gagcgcatggtcgtcgaactgcgcgacaaggtcgacgccgtcgcgacgaccgccggcgcg
gcttccggtgccgtcgtcggcagttcgatccgtgatcagatcgtcgaggcgctcgaaggt
ctgggcttcccgatcaagcaggccgagcaagccacggattcggtcctggcggaatcgccc
gaggccacaacgtcggtagcactgcgctctgctctgtcgctgctcggtaagactcgatga

DBGET integrated database retrieval system