KEGG   Rhodococcus erythropolis PR4: RER_30000Help
Entry
RER_30000         CDS       T00881                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:rer00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:rer00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
3211900..3212844
Genome map
AA seq 314 aa AA seqDB search
MKHLLSIADLDRESAVELLDEAERFEQALLGREVRKLPTLRGRTVMTVFFENSTRTRVSF
EVAGKWMSADVINVSASSSSVSKGESLRDTAMTLRAAGADALIVRHPASGAAHQIAKWTG
AADDGGPAVINAGDGTHEHPTQALLDALTLRQRLGDIEGKRIAIVGDILHSRVARSNALL
LSMLGAEVVLVAPPTLLPVGAHTWPVTVSHSLDAELPGLDAVLMLRVQAERMNGGFFPSQ
REYSINYGLSEKRLAMLADHAVVLHPGPMLRGMEIASAVADSSKTAVLQQVTNGVHMRMA
VLFRLLVGSEDGAL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcaccttctttccatcgcggacctcgatcgtgagtccgcggtagaacttctcgac
gaggcagaacgcttcgagcaggcgctgctgggccgcgaagtacgcaaactcccgacgctg
cgcggacgcacggtcatgacggtgttcttcgagaactcgacgcgcacccgggtgtccttc
gaggtggccggtaagtggatgagcgcggacgtcatcaacgtcagcgcatcgagttcctcg
gtgtccaagggcgaatccctgcgcgataccgcgatgaccctgcgcgcggccggtgccgac
gctctcatcgtgcggcatccggcttcgggtgccgcccatcagatcgccaagtggaccgga
gcggccgacgacggtggcccggcagtcatcaacgcaggtgacggcacgcatgagcatccc
actcaggcgcttctcgacgctttgacccttcgccagcgcctcggcgacatcgagggcaag
cggatcgcgatcgtcggcgacattctgcacagccgtgtggcccggtccaacgcgctgctt
ctgtcgatgctcggcgcagaggtcgtcttggtggcgcctccgacactgctgccggtcggc
gcgcacacgtggccggtcacggtctcgcattcgctcgacgccgaactgcccggactcgac
gcggtgctgatgctgcgggttcaggccgaacgcatgaacggcggcttcttcccttcgcag
cgcgagtactcgatcaactacggcctgtccgagaagcgactggcgatgctggccgatcac
gcggtggtcttgcaccccggtccgatgctgcgcggcatggagatcgcatccgccgtcgct
gattcctcgaaaactgctgtactgcaacaggttaccaacggcgtacacatgcgcatggct
gtcttgttccgactgctggtcgggtcggaggacggtgcgctgtga

DBGET integrated database retrieval system