KEGG   Rhodococcus erythropolis PR4: RER_30080Help
Entry
RER_30080         CDS       T00881                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RER_30080 (gmk)
Enzymes [BR:rer01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     RER_30080 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
3222096..3222695
Genome map
AA seq 199 aa AA seqDB search
MIADATVSESKTAVRRGRLVVLAGPSAVGKSSVVRELRTRLPELVFSVSATTRDPRPGEV
DGKDYRFTSREEFQRMIDSGELLEWAEIHGGLQRSGTPAAPIEEALEAGKPVLVEVDLAG
ARAVRKAMPEALLVFMAPPSWDVLVQRLTGRGTETEDVVARRLETARVELAAQDEFDTVI
VNEDVSRACDELVSLLVGN
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgattgctgacgcaacagtgtcagagagcaagaccgcagtgcggaggggtcggctggtt
gtactggccggcccttcggctgtcggtaagtccagcgtcgttcgcgagctgagaactcgg
ttgcctgaactcgttttcagcgtttcggcgaccactcgcgatccccgtcccggtgaagtg
gacggcaaggactaccgattcacctcccgtgaagaatttcaacggatgatcgactccggt
gaacttctcgaatgggcggaaatccacggcggtctacagcgctccggcacccccgcagct
ccgatcgaagaagcgctcgaagctggaaagcccgtactcgtcgaggtcgatctcgccgga
gcacgagctgtccgcaaggcgatgcccgaagctctgttggtgttcatggctccaccgagc
tgggacgttctggtgcaacggctgaccggacggggaaccgaaacggaagacgtcgtggca
cgccgactcgagacggcccgagtggaattggccgcgcaggacgagttcgacacggtcatc
gtgaacgaggatgtaagccgtgcttgcgatgagttggtatccttgttggttgggaactga

  All links  
No link information was found.   
DBGET integrated database retrieval system