KEGG   Rhodococcus erythropolis PR4: RER_30080Help
Entry
RER_30080         CDS       T00881                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
rer00230  Purine metabolism
rer01100  Metabolic pathways
Module
rer_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RER_30080 (gmk)
Enzymes [BR:rer01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     RER_30080 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_18 MMR_HSR1 RsgA_GTPase AAA_33 AAA_22 KTI12 ABC_tran
Motif
Other DBs
NCBI-ProteinID: BAH33716
NITE: RER_30080
UniProt: C0ZZD1
Position
3222096..3222695
Genome map
AA seq 199 aa AA seqDB search
MIADATVSESKTAVRRGRLVVLAGPSAVGKSSVVRELRTRLPELVFSVSATTRDPRPGEV
DGKDYRFTSREEFQRMIDSGELLEWAEIHGGLQRSGTPAAPIEEALEAGKPVLVEVDLAG
ARAVRKAMPEALLVFMAPPSWDVLVQRLTGRGTETEDVVARRLETARVELAAQDEFDTVI
VNEDVSRACDELVSLLVGN
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgattgctgacgcaacagtgtcagagagcaagaccgcagtgcggaggggtcggctggtt
gtactggccggcccttcggctgtcggtaagtccagcgtcgttcgcgagctgagaactcgg
ttgcctgaactcgttttcagcgtttcggcgaccactcgcgatccccgtcccggtgaagtg
gacggcaaggactaccgattcacctcccgtgaagaatttcaacggatgatcgactccggt
gaacttctcgaatgggcggaaatccacggcggtctacagcgctccggcacccccgcagct
ccgatcgaagaagcgctcgaagctggaaagcccgtactcgtcgaggtcgatctcgccgga
gcacgagctgtccgcaaggcgatgcccgaagctctgttggtgttcatggctccaccgagc
tgggacgttctggtgcaacggctgaccggacggggaaccgaaacggaagacgtcgtggca
cgccgactcgagacggcccgagtggaattggccgcgcaggacgagttcgacacggtcatc
gtgaacgaggatgtaagccgtgcttgcgatgagttggtatccttgttggttgggaactga

DBGET integrated database retrieval system