KEGG   Rhodococcus erythropolis PR4: RER_30300Help
Entry
RER_30300         CDS       T00881                                 

Gene name
pgk
Definition
(GenBank) phosphoglycerate kinase
  KO
K00927  
phosphoglycerate kinase [EC:2.7.2.3]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RER_30300 (pgk)
Enzymes [BR:rer01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     RER_30300 (pgk)
Exosome [BR:rer04147]
 Exosomal proteins
  Proteins found in most exosomes
   RER_30300 (pgk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
3244317..3245528
Genome map
AA seq 403 aa AA seqDB search
MAVQTLKDLLDAGVEGRTVLVRSDLNVPLDGGEITDPGRIVASAPTLRALAEGGAKVIVT
AHLGRPDGQPDPKFSLAPVAAKLAEILGRNVQLAGDVVGQDALARSEGLTDGDVLMLENI
RFDPRETSKDEAERVKLAKALVELVGDDGAFVSDGFGVVHRKQASVFDVAKLLPHYAGYL
VGAEVEVLAKLTQDAARPYAVVLGGSKVSDKLAVIEALAPKVDTLVIGGGMFYTFLAAQG
VSVGNSLCEESMIETCKGLLDRYADVIHIPQDVVVADSFSADAESKIVPFDKIPDGWMGL
DIGPESVKRFAAILTGAKTVFWNGPMGVFEFPKFEAGTRGVAEAIVEATEKGAFSVVGGG
DSAAAVRQLGIPDEGFSHISTGGGASLEYLEGKELPGIAVLEG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtggcagttcagacgctgaaggatctgctggacgctggggtcgaggggcgcaccgtactg
gtgcgttccgacctcaacgtcccgttggatggcggagaaatcacggacccgggccgcatc
gtcgcgtccgctcccaccctgcgggcacttgccgagggtggagcgaaggtcatcgtgacc
gcgcacctcgggcgccccgacggtcagcccgatcccaagttctccctcgcaccggttgcc
gcgaagttggccgaaatcctcggtcgcaacgtgcaactcgccggtgacgtcgtgggacag
gacgcgctggctcgttccgaaggactcaccgatggtgacgtcctgatgctcgagaacatc
cgtttcgaccctcgcgagaccagcaaggacgaagccgagcgggtcaagctcgccaaggct
ctcgtcgagctggtcggtgacgacggcgcattcgtctccgacggattcggtgttgttcac
cgtaagcaggcgtcggtcttcgacgtcgcgaagctgctcccgcattacgccggttacctg
gtcggcgccgaggtcgaggtgctcgccaagctcacgcaggacgctgcgcgtccgtacgcg
gtggtgctcggtggctccaaggtctcggacaagctggccgtcatcgaggcactggcaccg
aaggtcgacactctggtgatcggcggcggaatgttctacacgttcctcgcggctcagggt
gtctccgtgggcaattcgctgtgcgaagagtccatgatcgagacctgcaagggtctcctc
gaccggtacgccgacgtcatccacatccctcaggatgttgtcgtcgcggactccttctcg
gccgatgccgagtcgaagatcgttccgttcgacaagattcccgacggctggatgggtctg
gacatcggaccggagtcggtcaagcgctttgccgcgatcctgaccggcgccaagacggtg
ttctggaacggcccgatgggcgtgttcgagttcccgaagttcgaggcaggcacccgcggt
gtcgccgaagcaatcgtggaggcaaccgagaagggcgccttcagcgtcgtcggcggcggc
gactctgcagcagccgttcgtcagctcggtatcccggacgagggcttctcgcacatttcc
accggtggtggcgcttccctcgagtacctcgagggcaaagagctgcctggcatcgcagta
ctggaaggctga

DBGET integrated database retrieval system