KEGG   Rhodococcus erythropolis PR4: RER_30310Help
Entry
RER_30310         CDS       T00881                                 

Gene name
tpiA
Definition
(RefSeq) triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RER_30310 (tpiA)
   01230 Biosynthesis of amino acids
    RER_30310 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RER_30310 (tpiA)
   00051 Fructose and mannose metabolism
    RER_30310 (tpiA)
   00562 Inositol phosphate metabolism
    RER_30310 (tpiA)
Enzymes [BR:rer01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RER_30310 (tpiA)
Exosome [BR:rer04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RER_30310 (tpiA)
  Exosomal proteins of bladder cancer cells
   RER_30310 (tpiA)
  Exosomal proteins of melanoma cells
   RER_30310 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
3245535..3246320
Genome map
AA seq 261 aa AA seqDB search
MARKPLIAGNWKMNLNHLEAIALVQKIAFSLPAKYFDKVDVTVIPPFTDIRSVQTLIEGD
KLLLTYGAQDVSAQDSGAFTGEISGSMLAKLGCTFVVVGHSERRTLHGETNETVLAKTKA
ALKNGLTPIVCIGEGLEIREAGDHVAYNVDQLKGSLAGLSAEEISKIVIAYEPVWAIGTG
RVASAADAQEVCAAVRATVAELADAEVAAGVRVLYGGSVSSKNVGEIVGQTDVDGALVGG
ASLKADEFATLSAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtaagccgttgatcgccggcaactggaagatgaatctgaaccacctcgaggct
atcgccctggtgcagaagatcgctttctccttgcctgcgaagtacttcgacaaagtggac
gtcacggtcatcccgccgttcaccgacatccgtagcgtccagacgctgatcgagggcgac
aagctcctcctcacgtacggcgcgcaggatgtctcggctcaggactcgggtgcgttcacg
ggtgagatcagcggctccatgctggccaagctcggatgcaccttcgtcgtggtcggccac
tcggagcgtcgcacccttcacggtgagaccaacgagaccgtcctcgccaagaccaaggcc
gctctcaagaacggcctcacgccgatcgtgtgcatcggtgaaggcctcgagatccgcgaa
gcgggcgatcacgttgcctacaacgtcgaccagctcaagggttcactggcgggcctgagc
gcggaggagatctccaagatcgtcatcgcgtacgaacctgtctgggccatcggcaccggc
cgtgtcgcttctgccgccgatgcacaggaagtgtgcgctgcggtacgagcaacagttgcc
gaacttgccgacgccgaggtcgcagccggcgttcgcgttctgtacggcggcagcgtcagc
tccaagaacgtcggagagatcgtcggccagaccgacgtcgacggcgctctggtcggcggc
gcgtcgctcaaggctgacgagttcgcgacactgtctgcgatcgctgcaggcggtccactc
ccgtga

DBGET integrated database retrieval system