KEGG   Rhodococcus erythropolis PR4: RER_31400Help
Entry
RER_31400         CDS       T00881                                 

Definition
(GenBank) putative oxidoreductase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
rer00984  Steroid degradation
rer01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    RER_31400
Enzymes [BR:rer01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     RER_31400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C GMC_oxred_N TAT_signal NAD_binding_8 DAO Pyr_redox_2 Mqo FAD_binding_2 Pyr_redox_3 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: BAH33848
NITE: RER_31400
UniProt: C0ZZR3
Position
3405319..3406974
Genome map
AA seq 551 aa AA seqDB search
MQRRDMQRRDFFKAAGVGAAVAAATPLMSTSISHAAPAPLRALPMGADHYRALVPELFVP
SPTPPEHSEAIVIGSGFGASATALRLAQSGTQVTILERGLRWPHDPQREIHTSDMLADGR
GVFRRTSFTNLTGLPVVCDYFSGVLDATDYEHISVWRGAAVGGGSIIFTGVMIAPERRFF
DAVFGNSLDYDEMASTWYPKVRQMLRLSPLPEDIYQTPNFGHSRRWDQDARRAGFDPQRI
DGIWNWDVVRSELDGRTRASATVGDSNMGNSNGAKFDLTQNYIPAAEATGRATVCYGHQV
LAISRERDGRYVVDVESTDPTGGVLARKTLTCDRLFLGAGSIGTSELLVRAQATGALPNL
NEHVGKGWGTNGDAGMVRSFGFSDGTAQAAPSASRIVDESGMPLSLENWYVPGLPVNIGM
LGTLGMTLDSQRADFAYDGGNDRVVLNWPKNGNDATVEALRAVQNKMAFAGTTLPSALPF
AKDVNSSFTAHPLGGAVLGKATDGYGRVKGYDGLYVMDGAAIPGSTGTVNPSLTITALAE
RNIAQIIKSGR
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgtcgtgacatgcagcgtcgtgactttttcaaagcggccggagtgggggcagca
gttgcagccgcgacaccgctcatgtcgacctcgatcagccacgccgcccccgcgcctctg
cgtgcgctaccgatgggtgccgatcactaccgcgcactcgtccccgagttgttcgtaccc
tcgcccactcccccggaacattccgaagccatcgtcatcgggtcaggtttcggcgccagc
gcgaccgctctccggttggcgcagagcggcacccaggtcaccatcctcgaacgcggactc
cgatggccgcatgatccgcagcgggagattcacacctccgacatgctggccgacggccgc
ggagttttccggcgcacatcgttcaccaacctcaccggactcccggtggtgtgcgactac
ttcagcggcgtcctcgatgccaccgactacgaacacatctcggtctggcgcggcgctgca
gtcggcggtggttccatcatcttcaccggcgtgatgatcgcgcccgagcgccgattcttc
gacgcagtcttcggcaactccctcgactacgacgagatggcgtccacctggtaccccaag
gtgcgccagatgctgcgtctgagcccgttgcccgaagacatttaccaaaccccgaatttc
ggtcactcgcgtcgttgggatcaggacgctcgtcgtgccggattcgatccgcagcggatc
gacgggatctggaactgggacgtggtgcgctcagaactcgacggccgaacccgagcctcg
gccactgtcggtgacagcaacatgggtaactccaacggcgcgaagttcgacctcacacag
aactacattcccgccgccgaagccaccggacgagccaccgtctgttacggacatcaggtg
ctcgcgatcagtcgcgaacgtgatggacgctacgtcgtcgacgtcgaatcgacggatccg
acgggtggcgttctggcccggaagactcttacctgtgaccgtctgttcctcggcgccggc
tcgatcggcacctccgaactgctggtacgcgcccaggcgacgggcgcgctgccgaacctc
aacgaacacgtcggtaagggctggggaacgaacggcgacgccgggatggtgcgctcgttc
ggcttcagtgacggcactgcgcaagccgcaccgtcggcatcacggatcgtcgacgagtcg
ggaatgccactctccctggaaaactggtacgtccccggcctacccgtcaacatcggcatg
ctcggaaccttgggtatgaccctcgattcgcagcgcgccgacttcgcctacgacgggggc
aacgatcgggtggtgctgaactggccgaagaacggcaacgacgccaccgtcgaggccctg
cgcgccgtccagaacaagatggccttcgccggcaccacgctgccgtccgccttgccgttc
gcgaaagacgtcaattcctcgttcaccgcgcatcccctcggcggtgcggttctcggcaag
gcaaccgacggctacgggcgagtcaagggctacgacggcctgtacgtgatggacggcgct
gccattccgggcagcaccggcaccgtcaatccgtcactgaccatcactgctctggcggag
cggaacatcgctcagatcatcaagtccggacgctga

DBGET integrated database retrieval system