KEGG   Rhodococcus erythropolis PR4: RER_33520Help
Entry
RER_33520         CDS       T00881                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RER_33520 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RER_33520 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RER_33520 (trpA)
Enzymes [BR:rer01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RER_33520 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(3640660..3641463)
Genome map
AA seq 267 aa AA seqDB search
MSERPSRLAPTFAACKADKRAALVGYLPAGYPTVPESIDVFKAMVDGGCDIIEVGVAYSD
PVMDGPTIQRAAETALTNGVRLRDIFTVIEQISSVGGKAVVMTYWNPVLQYGVDKFARDL
ASAGGLGLITPNLIPEEAGAWMEASEEHHLDRIFLVAPSSTEERLAMTLDASSGFIYAAS
TMGVTGARDAVSSMAPELTARIRAHSDIPVGVGLGVRSGAQAAEIAAYADAVIVGSALVS
AVENGLGAVRSLTEELAEGVRSATVAS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaacgaccatcacgcctcgcacccacctttgcagcgtgcaaggctgacaagcgt
gccgccctcgtcggttacctgcctgccggttatccgaccgttcccgaatcgatcgacgtg
ttcaaggcgatggtcgacggtggctgcgacatcatcgaagtcggtgtcgcgtattccgat
ccggtcatggacggtccgaccatccagcgtgcagccgaaaccgcactcaccaacggcgtt
cgccttcgcgacatcttcaccgtgatcgagcagatcagttcggtcggcggcaaggccgtc
gtgatgacctactggaacccggtactgcagtacggcgtcgacaagttcgcacgagacctc
gcttctgccggcgggctcggactcatcacccccaacctcattccggaagaagcaggcgcc
tggatggaagcatccgaggagcaccacctcgaccgaatcttccttgtcgccccgtcctcg
acggaagaacggctcgcgatgacactcgacgcgagtagtggattcatctacgcggcctcg
acaatgggtgtcaccggcgctcgcgacgccgtgtcttcgatggctccggaactgaccgca
cgaatccgcgcgcattccgacattcccgtcggcgtcggattgggtgttcggtccggcgca
caagctgccgaaatcgcggcatacgccgatgccgtcatcgtcggctcggctctggtctcc
gcggtcgagaacggcttgggagcggttcgctcgctcaccgaagaactcgccgagggcgtc
cgctcggctaccgtggcgtcgtga

DBGET integrated database retrieval system