KEGG   Rhodococcus erythropolis PR4: RER_33530Help
Entry
RER_33530         CDS       T00881                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RER_33530 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RER_33530 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RER_33530 (trpB)
Enzymes [BR:rer01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RER_33530 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(3641460..3642809)
Genome map
AA seq 449 aa AA seqDB search
MTSRTQEPGSGAVFKGGNLPPASAGLTERSHDPDAGGHFGVYGGRHVPEALMAVIEEVTA
EYEKARADDTFLNELDRLQRDYTGRPSPIFEATRMSEFAGGARIILKREDLNHTGSHKIN
NVLGQVLLAKRMGKTRIIAETGAGQHGVASATACALLGLECVIYMGAVDTERQALNVARM
RLLGAEVVSVETGSRTLKDAINEALRDWVSHADNTYYCFGTAAGPHPFPTIVRDFQRVVG
LETRVQVQALTGRLPDAVTACVGGGSNAIGIFHPFIDDLSVRLVGYEAAGDGVETGRHAA
TFAGGTPGAFQGAYSYLLQDEDGQTIESHSISAGLDYPGVGPEHAYLSDIGRATYEPVTD
SEAMDALLLLSRREGIIPAIESAHAVAGALRLGKELGEGAIIVVNLSGRGDKDMDTAASW
FGLFDGASSQATAPADAADQNDNTEGSDK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtgacttcacgtactcaggaaccaggctccggtgcagtattcaagggcggcaatctgccg
ccggccagcgcgggactcaccgagcgctctcacgacccggatgccggagggcatttcggc
gtctatggcggacggcatgtgccggaagccctcatggcggttatcgaggaagtcactgcg
gagtacgaaaaggctcgcgcggacgacacgttcttgaacgaactcgatcgcttgcagcgc
gattacaccgggcgtccgtcgccgattttcgaggcaacgcgaatgagcgagttcgccggc
ggtgcgcgcatcattctcaagcgtgaagatctgaaccacaccggttctcacaagatcaac
aacgttctcggtcaggttctgctggcgaagcgtatgggtaagactcgcatcatcgccgag
accggagcgggccagcacggtgtggcatcggccaccgcctgtgcactgctcggtctcgag
tgcgtcatctacatgggtgctgtcgacaccgaacgtcaagcactgaacgtcgcacgcatg
cgcctgctcggcgcggaggtcgtctcggtcgagaccggttcgcgcacgctcaaggacgcg
atcaacgaagccttgcgcgactgggtttcccacgcggacaacacctattactgcttcggt
accgcggcaggcccgcacccgttccccaccatcgttcgcgacttccagcgagtggtcggc
ctcgaaacacgcgtccaggttcaggcactgaccggccgcctgcccgatgcagtcacagcc
tgcgtcggaggcggctccaacgcaatcggaatcttccacccgttcatcgacgatctgtcg
gtacggctggttggctacgaagcagccggcgacggtgtcgaaaccggaaggcatgcagca
acgttcgccggcggtacccctggcgcattccagggtgcctactcctacctgctccaggac
gaagacggtcagaccatcgaatcgcactcgatctctgctggtctggactacccgggcgtc
ggacccgagcacgcttacctgagcgatatcgggcgtgccacctacgaacccgtcaccgac
agcgaagcgatggatgctctactgctgctctcgcgccgcgaaggcatcatcccggccatc
gaatccgcccacgccgttgccggcgcgctccgactgggcaaggaactcggcgagggcgcg
atcatcgtcgtcaatctctccggtcgcggtgacaaggacatggacaccgccgcaagctgg
ttcggtctcttcgacggcgcctcgagtcaggcaaccgctccggctgatgcagcagaccag
aacgacaacacggaaggctcggacaagtga

DBGET integrated database retrieval system