KEGG   Rhodococcus erythropolis PR4: RER_33540Help
Entry
RER_33540         CDS       T00881                                 

Gene name
trpC
Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RER_33540 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RER_33540 (trpC)
Enzymes [BR:rer01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     RER_33540 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(3642884..3643741)
Genome map
AA seq 285 aa AA seqDB search
MTYLTSGSCPERIRATMTVLDSILDGVRADVAAREAVLDFAAVKAAAAAAPPALDAAAAL
LESSIGVIAEVKRASPSKGALADIADPAELAAAYQAGGARIISVLTEERRFHGSLADLDA
VRKAVTIPVLRKDFIVGPYQIHEARAHGADVILLIVAALEQQALASLIDRTESLGMTALV
EVHTEEEANRALEAGAKVIGVNARNLKTLEVDKNTFGRIAPGLPTETIKIAESGVRGTAD
LLAYAGAGADAVLVGEGLVTSGDPRKAVADLVNAGAHPSCPKPSR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgacgtatctcacatcgggctcttgcccagaaaggattcgggccacgatgaccgtactc
gactcgattctcgacggggtgcgcgctgatgtcgccgcccgcgaagccgtactcgacttc
gctgcagtcaaggctgctgcggccgctgcaccgcctgcactcgatgctgcagcagcactt
ctggaatcgagcatcggcgtcatcgccgaggtcaagcgagcgagcccctcaaagggtgcg
ctggccgacattgccgatcccgcagagcttgccgcggcttaccaagccggtggcgcacgc
atcatcagtgttctcaccgaagagcgccgttttcacggctcgttggccgacctcgacgca
gtccgtaaagcggtcaccattccggtgctgcgcaaggacttcatcgtggggccgtaccag
attcacgaagctcgcgctcacggcgccgacgtcatcttgctgatcgtcgcggcactcgaa
cagcaggcgctcgcctcgctgatcgatcgcaccgaatctctgggaatgactgccctcgtc
gaggtgcacaccgaggaagaagccaaccgcgcgctcgaagccggcgccaaggtgatcggt
gtcaacgcgcgcaatctcaaaaccctcgaggtggacaagaacaccttcggtcgcattgct
cccggtctgccgaccgagacgatcaagatcgccgaatcgggtgttcgcggaactgccgat
ctgttggcgtacgccggtgcgggcgccgacgcagtgctcgtcggtgaaggcctcgtgacc
agcggcgaccctcgcaaggccgtcgcagatctggtcaatgccggtgcacacccgtcctgc
cccaaaccgtctcgataa

DBGET integrated database retrieval system