KEGG   Rhodococcus erythropolis PR4: RER_33540Help
Entry
RER_33540         CDS       T00881                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
rer00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rer01100  Metabolic pathways
rer01110  Biosynthesis of secondary metabolites
rer01130  Biosynthesis of antibiotics
rer01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RER_33540 (trpC)
Enzymes [BR:rer01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     RER_33540 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh OMPdecase
Motif
Other DBs
NCBI-ProteinID: BAH34062
NITE: RER_33540
UniProt: C1A0C7
Position
complement(3642884..3643741)
Genome map
AA seq 285 aa AA seqDB search
MTYLTSGSCPERIRATMTVLDSILDGVRADVAAREAVLDFAAVKAAAAAAPPALDAAAAL
LESSIGVIAEVKRASPSKGALADIADPAELAAAYQAGGARIISVLTEERRFHGSLADLDA
VRKAVTIPVLRKDFIVGPYQIHEARAHGADVILLIVAALEQQALASLIDRTESLGMTALV
EVHTEEEANRALEAGAKVIGVNARNLKTLEVDKNTFGRIAPGLPTETIKIAESGVRGTAD
LLAYAGAGADAVLVGEGLVTSGDPRKAVADLVNAGAHPSCPKPSR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgacgtatctcacatcgggctcttgcccagaaaggattcgggccacgatgaccgtactc
gactcgattctcgacggggtgcgcgctgatgtcgccgcccgcgaagccgtactcgacttc
gctgcagtcaaggctgctgcggccgctgcaccgcctgcactcgatgctgcagcagcactt
ctggaatcgagcatcggcgtcatcgccgaggtcaagcgagcgagcccctcaaagggtgcg
ctggccgacattgccgatcccgcagagcttgccgcggcttaccaagccggtggcgcacgc
atcatcagtgttctcaccgaagagcgccgttttcacggctcgttggccgacctcgacgca
gtccgtaaagcggtcaccattccggtgctgcgcaaggacttcatcgtggggccgtaccag
attcacgaagctcgcgctcacggcgccgacgtcatcttgctgatcgtcgcggcactcgaa
cagcaggcgctcgcctcgctgatcgatcgcaccgaatctctgggaatgactgccctcgtc
gaggtgcacaccgaggaagaagccaaccgcgcgctcgaagccggcgccaaggtgatcggt
gtcaacgcgcgcaatctcaaaaccctcgaggtggacaagaacaccttcggtcgcattgct
cccggtctgccgaccgagacgatcaagatcgccgaatcgggtgttcgcggaactgccgat
ctgttggcgtacgccggtgcgggcgccgacgcagtgctcgtcggtgaaggcctcgtgacc
agcggcgaccctcgcaaggccgtcgcagatctggtcaatgccggtgcacacccgtcctgc
cccaaaccgtctcgataa

DBGET integrated database retrieval system