KEGG   Rhodococcus erythropolis PR4: RER_33980Help
Entry
RER_33980         CDS       T00881                                 

Definition
putative phosphofructokinase (EC:2.7.1.-)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RER_33980
   01230 Biosynthesis of amino acids
    RER_33980
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RER_33980
   00030 Pentose phosphate pathway
    RER_33980
   00051 Fructose and mannose metabolism
    RER_33980
   00052 Galactose metabolism
    RER_33980
  Energy metabolism
   00680 Methane metabolism
    RER_33980
Enzymes [BR:rer01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RER_33980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(3717095..3718063)
Genome map
AA seq 322 aa AA seqDB search
MEQSDSRVVTVTMNPALDIATSARAVHTTDKVRCVAPRRDPGGGGLNVARVLRVLGGDVM
AVFPSGGHCGLAVEDLLIGEQVRHWAEPVSGSTRESFTVDDESTGEQYRFVLPGPILTVA
EVESCLARVREFAVDSGYVVVSGSLPPGVGADFVQRLVDYLEGTGARLVVDTSGAALRAL
KSGVFLVKPSIRELREWVDHPLETRVEQVDAARTIVAQKVAEVVVVSLGAAGALLVTADM
CECVPSVDVVSISGVGAGDSMVAGMVYSLIHQRSLMDAVRFGVAAGAAMLKTPGTAPCSP
ADVEVFYERIRAGADRGVIRPD
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggagcagagtgactctcgcgtcgtaacggtgacgatgaacccggcactcgacatagcg
accagcgcgcgtgccgtccacacgacagacaaggtgcgttgtgtggcacctcgtcgtgat
cccggcggcggcggattgaacgtcgcgcgagtgctccgggtcctcggcggcgacgtgatg
gcagtgtttccctcgggaggtcattgtggcctggcggtcgaggaccttctgatcggtgaa
caagtgcggcattgggccgagcccgtctcagggtcgactcgcgagagttttaccgtggac
gatgagtcgacaggtgagcagtatcgttttgtgttgcctggaccgattctcaccgttgca
gaggtggaatcgtgtctcgctcgagtgcgtgaattcgccgtcgattccggatatgttgtc
gtgagcggcagtttgccaccgggggtgggtgctgattttgttcagcggttggtcgattac
ctcgagggaaccggggcgcggctggttgtcgacacctctggcgctgcattgcgcgcattg
aagagtggtgtctttcttgtcaagccgagtatccgcgagcttcgtgaatgggtcgaccac
ccactcgagactcgggtggagcaagtcgacgcagcgagaactattgttgcgcagaaggtt
gcggaggtggtggtcgtttcgcttggagccgctggagccttgctggtgactgccgacatg
tgtgagtgtgtgccgtcggtggacgtcgtatcgatcagtggtgtgggcgcgggggacagc
atggttgcgggcatggtgtattcgctcatccatcagcgttcgctgatggatgcggttcgg
ttcggtgttgcagccggggccgcgatgttgaagaccccagggacggcaccgtgttcacca
gccgacgtggaggtcttctatgaacggattcgtgcaggagcagatcggggagtgatccga
cccgactag

DBGET integrated database retrieval system