KEGG   Rhodococcus erythropolis PR4: RER_36030Help
Entry
RER_36030         CDS       T00881                                 

Gene name
ltsA
Definition
probable glutamine amidotransferase LtsA
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RER_36030 (ltsA)
Enzymes [BR:rer01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     RER_36030 (ltsA)
Peptidases [BR:rer01002]
 Cysteine Peptidases
  Family C44
   RER_36030 (ltsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
3947211..3949136
Genome map
AA seq 641 aa AA seqDB search
MCGLLGLLTSGGTSEDAVSRVDQAMHCLRHRGPDEHGTWNDDHLVFGFNRLAIIDIAHSH
QPLRWGPPENPERYALTFNGEIYNYLEIRAELVKEHDAKFFTEGDSEAIVAAFHYWGEDA
VRRLRGMFAFAIWDTDTRELFIARDPFGIKPLFIATGAGGTAFGSEKKSLLELTDLIGIG
TELDPRAIEHYTVLQYVPEPETLHKEIRRLESGSFARVRPGEEPTFTRYFTPKFPAKPFA
PGTEKARYQEIAEALEDSVAKHMRADVTVGSFLSGGIDSTAIAALAMRHNPNLITFTTGF
EREGYSEVDVAAESAAAIGAKHVVKVVSPAEFAAAIPEIVWYLDDPVADPALIPLWFIAK
EARKHVKVVLSGEGADELFGGYTIYREPLSLKPFEYLPKGLRRAAGKLSERIPDGTRGKS
LLNRGSLTLEERYYGNARSFNDAQLRAVLRDFRPEWTHQDVTAPIYAQSRDWDPVARMQH
LDLFTWLRGDILVKADKMTMANSLELRVPFLDPEVFDVASRVPLDQKITKDTTKYALRQA
LEGIVPHHVLHRAKLGFPVPLRHWLRGTELFDWAHLQIEESGTDHIFDKQAVVKMLNDHR
EGVSDHSRRLWTVLTFMVWHGIFVEKRIVPQIQEPVYPVNI
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtggactgctcgggctactgacatctggcggaaccagcgaggacgccgtctcgcgg
gtcgaccaggcgatgcattgccttcgtcaccgcgggccggacgaacacgggacgtggaac
gacgaccacctcgtcttcgggttcaaccgcctggcgatcatcgacatcgctcattcccac
cagccgctgcgttggggcccaccggagaacccggagcgttatgcgctcacgttcaacggc
gagatctacaactacctggagatccgcgccgaactggtcaaggaacacgacgccaagttc
ttcaccgagggcgactccgaggccatcgtcgctgcattccactactggggtgaggatgcg
gtccggcgcctacgcggaatgttcgcgttcgcgatctgggacaccgacacacgcgagctg
ttcatcgcgcgcgatccgttcgggatcaagccgctgttcattgctaccggcgccggcggc
accgcgttcggcagtgagaagaagagcctgctcgaactcaccgatctgatcggcatcggt
accgagctggatccgcgcgccatcgagcactacaccgttctgcagtacgtaccggagccg
gaaacactgcacaaggagatccgacgcctggagtcgggcagcttcgctcgggtgcgtccg
ggcgaggaacccacgttcacgcggtacttcacgccgaagttcccggccaagccttttgca
cctggcaccgagaaggcgcgctaccaggaaatcgccgaggcactcgaggattcggtcgcc
aagcacatgcgcgccgacgtcaccgtcggttcgttcctgtccggtggtatcgactccacg
gcgatcgcggcactggcgatgcgccacaaccccaacctgatcaccttcacgaccggtttc
gaacgtgagggctattccgaggtcgacgtcgctgcagaatctgccgcggcgatcggcgcg
aagcacgtcgtcaaggtggtctcccccgccgagttcgccgctgccattcccgagatcgtc
tggtacctcgacgacccggtagccgatccggcattgattccgctgtggttcatcgccaag
gaagcccgcaagcacgtcaaggtcgtgctgtccggcgagggcgccgacgagctgttcggc
ggctacacgatttaccgtgagccgttgtcgctcaagcctttcgagtacctccccaaggga
ttgcgtcgggctgcgggcaagctgtccgaacgcatcccggacggtactcgcggcaagagt
ctgctcaatcgcggctcgttgaccctcgaggagcgctactacggcaatgctcgtagcttc
aacgacgctcaacttcgcgccgtccttcgcgatttccgccccgagtggactcaccaggac
gtcaccgcgccgatctacgcgcagtcacgggactgggatccggttgcgcggatgcagcat
ctcgacctgttcacctggctgcgcggcgacatcctcgtcaaggccgacaagatgacgatg
gccaactcgctggaactgcgtgtgccgttcctcgatcccgaggtcttcgacgtagcgtca
cgcgtgccgctcgatcagaagatcacgaaggacacaaccaagtacgcactgcgccaggcc
ttggaaggcattgtgccgcaccatgttctgcaccgtgcgaagctcggattcccggttccc
ctacgccattggctacgcggcacagaactcttcgactgggcacatctgcaaatcgaggag
tcgggtaccgaccacatcttcgacaagcaggccgtcgtgaagatgctcaacgatcaccgc
gagggcgtttccgaccacagccgacgcctgtggaccgtgctgacgttcatggtctggcac
gggatcttcgtggagaagcgcatcgtgccgcagatccaggaaccggtgtacccggtcaac
atctag

DBGET integrated database retrieval system