KEGG   Rhodococcus erythropolis PR4: RER_36170Help
Entry
RER_36170         CDS       T00881                                 

Definition
(RefSeq) dihydrolipoamide acyltransferase (EC:2.3.1.-)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RER_36170
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RER_36170
  Amino acid metabolism
   00310 Lysine degradation
    RER_36170
Enzymes [BR:rer01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RER_36170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
3961871..3963619
Genome map
AA seq 582 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKQEGDTVEVDEPLLEVSTDKVDTEIPSPVAGVLTKIV
AQEDDTVEIGGELAQIGEAGEAAAPEAEAPAPAAEEAPAEEAPAAEEPAEETPAAEAPAA
SGGSAEGTAVTMPALGESVTEGTVTRWLKAVGDEVAVDEALLEVSTDKVDTEIPSPVAGI
LLEINAQEDDTVEIGGQLAVVGSGAPAAAPAPKAAPAAPAAPPAPKAEAPKAEAPKAEAP
KPAAAPAAPAPKPAAAPAPAAAPAASGDSSPYVTPLVRKLATDNGVDLATVTGTGVGGRI
RKQDVLAAAEAKKAPAAAAPAAAPAAAPAATAAAGVRPELAHLRGTTQKANRIRQITATK
TRESLQNTAQLTQTFEVDVTKIVALRARAKAGFIEREGVNLTFLPFFAKAVVEALKSHPN
INASYDEAAKQITYYDAEHLGIAVDTDQGLLSPVIHNAGDLGLAGLARAIADIAKRARSG
GLKPDELSGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIVKRPMVVTDENGNESIGV
RSMIYLPLTYDHRLVDGADAGRFLTTVKQRLEEASFEADLGL
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgccagccctaggtgagagcgtcaccgagggaactgtcaca
cggtggctcaagcaggaaggagacacggtcgaagtcgacgaacccttgctcgaagtctcc
acggacaaggtcgacaccgagattccgtctcccgtcgccggcgtcctgaccaagatcgtc
gcgcaggaagacgacaccgtggaaatcggtggcgagctcgcccagatcggtgaagccggc
gaagccgcagcacccgaggcagaggcacccgcccccgccgcagaggaagctcccgccgag
gaagccccggctgccgaggaacccgccgaagaaactcccgctgccgaggcacccgctgct
tccggcggttccgctgaaggcaccgccgtgacgatgcccgccctcggcgagtccgtcacc
gaaggcaccgtcacccgctggctcaaggccgtcggcgacgaggttgccgtcgacgaggcg
ctgctcgaagtctcgaccgacaaggtcgacaccgaaatcccgtcccccgtcgccggaatc
ctgctcgagatcaatgcgcaggaagacgacaccgtcgagatcggtggccagctggccgtc
gtcggatccggcgcacccgccgcggctccggcacccaaggccgctcccgcagcaccggcc
gctccgccggcacccaaggctgaagcaccgaaggctgaggcacccaaggccgaggcaccc
aagcctgctgccgcaccggccgcacccgctccgaagcctgctgcagctcccgcaccggcg
gccgcacccgcagcttccggcgacagcagcccgtacgtcaccccgctcgtgcgcaagctc
gccacggacaacggcgtcgacctcgcgaccgtcaccggcaccggcgtcggcggccgtatc
cgcaagcaggatgtgctcgccgctgcggaggccaagaaggctcccgccgccgctgctcct
gctgcagcacccgcggccgcaccggccgccaccgcagccgcaggcgtccgaccggaactg
gcacacctgcgcggaaccacgcagaaggccaaccgtattcggcagatcacggccaccaag
acgcgtgagtcgctgcagaacaccgctcagctcacgcagaccttcgaggtggacgtcacc
aagatcgtcgccctgcgggcccgtgccaaggccggcttcatcgagcgcgaaggcgtcaac
ctgacgttccttccgttcttcgccaaggcagtcgtcgaggcgctgaagtcgcacccgaac
atcaacgccagctacgacgaggctgccaagcagatcacctactacgacgctgagcacctc
ggcatcgcagtggacaccgatcagggcttgctctcccccgtcatccacaacgccggcgat
ctcggccttgccggtttggctcgcgccatcgccgacatcgcgaagcgtgcacgctcgggt
ggcctgaagccggacgagctctcgggtggaaccttcaccatcaccaacatcggcagccag
ggcgcgctgttcgacaccccgatcctggtaccgccgcaggcggccatgctcggaaccggc
gcgatcgtcaagcgcccgatggtggtcaccgacgagaacggcaacgagtccatcggcgtt
cgctcgatgatctacttgccgctgacctacgatcaccgtctggtcgacggcgccgacgcc
ggccgattcctcaccactgtgaagcagcggttggaagaagcctcgttcgaagctgatctg
ggcctgtaa

DBGET integrated database retrieval system