KEGG   Rhodococcus erythropolis PR4: RER_36170Help
Entry
RER_36170         CDS       T00881                                 

Definition
(GenBank) dihydrolipoamide acyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
rer00020  Citrate cycle (TCA cycle)
rer00310  Lysine degradation
rer01100  Metabolic pathways
rer01110  Biosynthesis of secondary metabolites
rer01120  Microbial metabolism in diverse environments
rer01130  Biosynthesis of antibiotics
rer01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RER_36170
  Amino acid metabolism
   00310 Lysine degradation
    RER_36170
Enzymes [BR:rer01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RER_36170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: BAH34325
NITE: RER_36170
UniProt: C1A140
Position
3961871..3963619
Genome map
AA seq 582 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKQEGDTVEVDEPLLEVSTDKVDTEIPSPVAGVLTKIV
AQEDDTVEIGGELAQIGEAGEAAAPEAEAPAPAAEEAPAEEAPAAEEPAEETPAAEAPAA
SGGSAEGTAVTMPALGESVTEGTVTRWLKAVGDEVAVDEALLEVSTDKVDTEIPSPVAGI
LLEINAQEDDTVEIGGQLAVVGSGAPAAAPAPKAAPAAPAAPPAPKAEAPKAEAPKAEAP
KPAAAPAAPAPKPAAAPAPAAAPAASGDSSPYVTPLVRKLATDNGVDLATVTGTGVGGRI
RKQDVLAAAEAKKAPAAAAPAAAPAAAPAATAAAGVRPELAHLRGTTQKANRIRQITATK
TRESLQNTAQLTQTFEVDVTKIVALRARAKAGFIEREGVNLTFLPFFAKAVVEALKSHPN
INASYDEAAKQITYYDAEHLGIAVDTDQGLLSPVIHNAGDLGLAGLARAIADIAKRARSG
GLKPDELSGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIVKRPMVVTDENGNESIGV
RSMIYLPLTYDHRLVDGADAGRFLTTVKQRLEEASFEADLGL
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgccagccctaggtgagagcgtcaccgagggaactgtcaca
cggtggctcaagcaggaaggagacacggtcgaagtcgacgaacccttgctcgaagtctcc
acggacaaggtcgacaccgagattccgtctcccgtcgccggcgtcctgaccaagatcgtc
gcgcaggaagacgacaccgtggaaatcggtggcgagctcgcccagatcggtgaagccggc
gaagccgcagcacccgaggcagaggcacccgcccccgccgcagaggaagctcccgccgag
gaagccccggctgccgaggaacccgccgaagaaactcccgctgccgaggcacccgctgct
tccggcggttccgctgaaggcaccgccgtgacgatgcccgccctcggcgagtccgtcacc
gaaggcaccgtcacccgctggctcaaggccgtcggcgacgaggttgccgtcgacgaggcg
ctgctcgaagtctcgaccgacaaggtcgacaccgaaatcccgtcccccgtcgccggaatc
ctgctcgagatcaatgcgcaggaagacgacaccgtcgagatcggtggccagctggccgtc
gtcggatccggcgcacccgccgcggctccggcacccaaggccgctcccgcagcaccggcc
gctccgccggcacccaaggctgaagcaccgaaggctgaggcacccaaggccgaggcaccc
aagcctgctgccgcaccggccgcacccgctccgaagcctgctgcagctcccgcaccggcg
gccgcacccgcagcttccggcgacagcagcccgtacgtcaccccgctcgtgcgcaagctc
gccacggacaacggcgtcgacctcgcgaccgtcaccggcaccggcgtcggcggccgtatc
cgcaagcaggatgtgctcgccgctgcggaggccaagaaggctcccgccgccgctgctcct
gctgcagcacccgcggccgcaccggccgccaccgcagccgcaggcgtccgaccggaactg
gcacacctgcgcggaaccacgcagaaggccaaccgtattcggcagatcacggccaccaag
acgcgtgagtcgctgcagaacaccgctcagctcacgcagaccttcgaggtggacgtcacc
aagatcgtcgccctgcgggcccgtgccaaggccggcttcatcgagcgcgaaggcgtcaac
ctgacgttccttccgttcttcgccaaggcagtcgtcgaggcgctgaagtcgcacccgaac
atcaacgccagctacgacgaggctgccaagcagatcacctactacgacgctgagcacctc
ggcatcgcagtggacaccgatcagggcttgctctcccccgtcatccacaacgccggcgat
ctcggccttgccggtttggctcgcgccatcgccgacatcgcgaagcgtgcacgctcgggt
ggcctgaagccggacgagctctcgggtggaaccttcaccatcaccaacatcggcagccag
ggcgcgctgttcgacaccccgatcctggtaccgccgcaggcggccatgctcggaaccggc
gcgatcgtcaagcgcccgatggtggtcaccgacgagaacggcaacgagtccatcggcgtt
cgctcgatgatctacttgccgctgacctacgatcaccgtctggtcgacggcgccgacgcc
ggccgattcctcaccactgtgaagcagcggttggaagaagcctcgttcgaagctgatctg
ggcctgtaa

DBGET integrated database retrieval system