KEGG   Rhodococcus erythropolis PR4: RER_37740Help
Entry
RER_37740         CDS       T00881                                 

Definition
putative phosphoglycerate mutase family protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RER_37740
   01230 Biosynthesis of amino acids
    RER_37740
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RER_37740
  Energy metabolism
   00680 Methane metabolism
    RER_37740
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RER_37740
Enzymes [BR:rer01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     RER_37740
Exosome [BR:rer04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   RER_37740
  Exosomal proteins of melanoma cells
   RER_37740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(4119071..4119745)
Genome map
AA seq 224 aa AA seqDB search
MTSSAPSAASNPVRRLILLRHGQTEYNADSRMQGQLDTDLSELGRTQAKSAGPVIADRRP
LTIVSSDLRRAYFTAVAVGDAAGLPVLTDTRLRETHLGEWQGLTHHDVDERTPGVRSAWR
ADATLAPPGGESRIDVANRSLPVVHELLDTHPDWAERPVVLVAHGGLIAALTAALLDLPV
DRWAVLGGLGNTSWVQLSGHGDVKSIEWRLDVWNASASVANDVL
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
gtgacttcgtcggcgcccagtgcggcgtcgaaccctgtccgccgactcatcctgctgcgt
cacggacagaccgaatacaacgccgactctcggatgcaggggcaactcgacaccgacctg
tcggagttgggacgcacgcaggccaagagtgcaggtccggtgatcgccgatcgcagaccg
ttgacgatcgtgtcctcggatctgcggcgcgcgtatttcacggcagtcgctgtcggtgac
gccgccggacttccggtcctcaccgacacgcgtctgcgtgagacacacctgggtgaatgg
caaggcctgactcatcatgacgtcgacgagcgcactcccggtgtgcgatctgcctggcgg
gcggatgccacgttggcgccgcccggcggcgaaagccgaatcgacgtcgcgaatcgcagc
ctccccgtagttcacgaattgctcgacacgcacccggactgggccgagcggcccgtagtt
ctggtggcgcacggaggcttgatcgcggcactgacagcggcattgctcgacttacccgtc
gatcgctgggccgtcctcggcggattgggaaacaccagttgggtgcaactcagcggacac
ggtgacgtcaagtcgatcgagtggcgactcgacgtatggaatgcttctgcgagtgtcgca
aatgacgtcctctga

DBGET integrated database retrieval system