KEGG   Rhodococcus erythropolis PR4: RER_37820Help
Entry
RER_37820         CDS       T00881                                 

Gene name
rbsK
Definition
probable ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RER_37820 (rbsK)
Enzymes [BR:rer01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     RER_37820 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
4127640..4128506
Genome map
AA seq 288 aa AA seqDB search
MSTPRIVVVGSINMDLTTSVARFPAPGETLLGTAFATAAGGKGSNQAIAAAKAGGDVSFI
GAVGDDGFGTQLRETLQGAGVDTALLRSVDGPSGVAAITVSEDAENNIIVVPGANSSITS
LTEADLDAISRADILLCQLEIPVETVTAAAEHAHANGTTVILNPSPVQELPAPLIDAVDI
LIVNQTESEQLAAVTGRVAYLVTTLGAGGADLKTGDETVHADSPAVTPVDTTGAGDAFTG
AFAVEWVQDQDRALQFAATAGSLATTVRGASVSSPTRAVIEKVLKRQA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgcctcgaatcgtcgtcgtcggcagtatcaacatggatctgaccacgtcggtg
gccagattccccgctccgggagaaacgctgctcggcactgcctttgccaccgcggccgga
ggtaagggcagtaaccaggccatcgccgccgcgaaggccggtggggacgtgtccttcatc
ggcgcggtcggcgacgacggtttcggcacccaattgcgcgagaccctacaaggcgccggg
gtcgacaccgcactgctacgtagtgtcgacggcccgagtggcgtcgcggccatcaccgtg
agcgaagacgcggagaacaacatcatcgtcgtcccgggcgccaattcctcgatcacttcg
ttgaccgaagcagacctcgacgcgatctcccgcgccgacatcctcctgtgccaactcgag
atcccggtcgagacagttacagcggcagccgagcacgcgcacgccaacgggacgacggtc
atcctcaatccgtctcccgtgcaagaacttccggctccactgatcgatgcagtcgacatc
ttgatcgtgaaccagaccgagtcggagcagctggccgcggtcaccggtcgcgtcgcgtac
ctcgtcacgacgctcggagcgggcggcgcggatctgaagaccggcgacgagaccgttcac
gccgactccccggccgtgacacccgtcgacaccaccggcgccggcgatgccttcaccggg
gccttcgccgtggagtgggtgcaggaccaggaccgcgccctgcagttcgctgccacggcg
ggaagtctggcgacgacggtccgcggcgcgtcggtgtcgtcgcccactcgcgctgtgatc
gagaaagtgctgaagcgtcaggcttga

DBGET integrated database retrieval system