KEGG   Rhodococcus erythropolis PR4: RER_38900Help
Entry
RER_38900         CDS       T00881                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RER_38900 (glgB)
Enzymes [BR:rer01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     RER_38900 (glgB)
Exosome [BR:rer04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RER_38900 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
4264192..4266396
Genome map
AA seq 734 aa AA seqDB search
MMPTEKSPSGIAPDNHDLELLARGEHHDPHSVLGAHPHADGTVLRALRPNAESVSAVIGG
KTFPLEHVSHGIFAALVPYPDLIDYRYSVTYPGGHTVLAADPYRFLPTLGELDLHLFGEG
RHERLWDILGAHPRSYETPDGPVDGTSFAVWAPAARGVTVVGDFDGWSGQFAPMRVLGST
GVWELFLPDIAVGSLYKFRVHGHDGSVRDKADPMAFGTEVPPATASRVTTSSHEWNDAAW
LETRAGVDPSQSPMSVYEVHLGSWRPGLDYRQMAEQLAVYVTETGFTHVELLPVSEHPFG
GSWGYQVTSYYAPTSRFGTPDDFRWFVDHLHAAGIGVIVDWVPAHFPKDEWALARFDGTP
LYEHADPRRGEQLDWGTYVFDFGRREVRNFLVANALFWLEEFHIDGLRVDAVASMLYLDY
SRPEGGWTPNIHGGRENLEAVAFLQEMNATVHKNHRGVVTVAEESTAWPGVTRATNVGGL
GFNMKWNMGWMHDTLGFLGHDPVHRTYHHHEITFSLMYAWSENYLLPISHDEVVHGKGTL
WTRMPGNDFAKASGLRSLLAYMWAHPGKQLLFMGQEFGQSAEWSEERGLDWWQLDDQYTG
TLHRGVQRLVGDLNSAYRRHPAMWTLDTSPGGYSWIDANDTENNVLSFLRYGTDGSIVAC
LFNFSGSEHSSYRVGLPEPGRWVEILNTDAEVYGGSGVGNLGAVTATSRSWHGRPASAQV
ALPAAGAIWISLER
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
gtgatgccaaccgaaaagtccccttcgggtatcgcgccggacaatcacgatctggaactg
ttggcgcgcggtgaacatcacgatccgcacagtgtcctcggcgcccatccccacgccgac
ggcaccgttctgcgagcgttgcgtcccaacgccgagtccgtcagcgccgtcatcggcggc
aaaacctttcctctcgaacatgtttcgcacggaatattcgcggccctggtcccctaccca
gacctgatcgactatcgctattccgtgacgtacccgggtggccacacagttctcgcagcc
gacccttaccgattcctgccgactctcggtgaactcgaccttcacctgttcggcgaaggt
cggcacgaacggctgtgggacatcctcggcgcacatccgcgttcgtacgagacaccggac
ggacccgtcgacggcacctcgttcgccgtctgggctccggccgcccgcggcgtgaccgtc
gtcggcgacttcgacgggtggagtgggcaattcgcccccatgcgagtcctcggctccacc
ggggtctgggaactcttcctgcccgacatcgcagtcggttcgctgtacaagttccgggtc
cacggccacgacggctcggttcgcgacaaggccgatcccatggcattcggtaccgaggta
ccgccggcgacggcgtcgcgagtgaccaccagttcgcacgaatggaacgacgcggcctgg
ctggaaacccgcgctggtgtcgacccttcgcagtccccgatgagcgtgtacgaggtgcac
ctcggatcgtggcgtccgggactcgactaccggcagatggccgagcaactcgccgtatac
gtcaccgaaaccggattcacccacgtcgaactgctgcccgtctccgagcatccgttcggt
ggatcgtgggggtaccaggtcacctcgtactacgcaccgacctcccgcttcggcaccccg
gacgacttccggtggttcgtcgaccacctgcatgccgcagggataggcgtcatcgtcgac
tgggtgcctgcacacttccccaaagacgaatgggcgcttgcccgtttcgacggaacgccg
ttgtacgagcacgccgatccgcgtcgcggcgagcagttggactggggcacatacgtattc
gacttcggtcgccgcgaggtccggaacttcctcgtcgccaacgcgctcttctggctcgag
gagttccacatcgacggactgcgcgtcgacgccgtcgcatcgatgctgtacctggactac
tcacgtccggaaggtggatggactcccaacattcacggtggccgcgagaatctcgaagcc
gttgcgttcctgcaggagatgaacgccaccgtccacaagaaccaccgaggagtcgtcacc
gtcgccgaggagtcgacggcgtggcccggagtcactcgggcgaccaatgtcggtggcctc
gggttcaacatgaaatggaacatggggtggatgcacgacaccctcggattcctcggtcac
gacccggtgcaccggacttaccaccatcacgagatcactttctcgctgatgtacgcgtgg
agtgagaactacctgctaccgatcagccatgacgaagtggtgcacggcaagggaactctg
tggacccggatgcccggcaacgacttcgccaaggcgtccggcctgcgctcactgcttgcg
tacatgtgggcgcatccgggcaagcaactgctgttcatgggacaggagttcggtcagagc
gcggaatggtccgaagaacgcggcctcgactggtggcaactcgacgatcagtacaccggc
actctccaccgcggcgtccagcgactggtcggagatctcaactccgcgtaccgacgccat
ccggcgatgtggaccctcgacacctcccccggcggatactcctggatcgacgccaacgac
accgagaacaacgtcctcagttttctgcgttacggtactgacggttcgattgtcgcctgc
ctgttcaacttttcgggcagtgagcactcgagctaccgcgtcgggctaccagagcccggc
cgatgggtggaaattctcaacaccgatgccgaggtgtatggcggctccggagtcgggaac
ctcggagcggtcacggcaacgtcgcgttcgtggcacggtcggccagcctccgcacaggtg
gcgctgccagctgctggagcgatttggataagtctggagcgttga

DBGET integrated database retrieval system