KEGG   Rhodococcus erythropolis PR4: RER_39210Help
Entry
RER_39210         CDS       T00881                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
rer00260  Glycine, serine and threonine metabolism
rer00750  Vitamin B6 metabolism
rer01100  Metabolic pathways
rer01110  Biosynthesis of secondary metabolites
rer01120  Microbial metabolism in diverse environments
rer01230  Biosynthesis of amino acids
Module
rer_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RER_39210 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RER_39210 (thrC)
Enzymes [BR:rer01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RER_39210 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAH34629
NITE: RER_39210
UniProt: C1A1Z4
Position
complement(4301462..4302544)
Genome map
AA seq 360 aa AA seqDB search
MTGIVNPVHKAWPGLIEAYRDRLAIGDNWKTVTLREGGTPLLPAGHLSEITGCDVYLKVE
GLNPTGSFKDRGMTMAVTDALARGQRAVLCASTGNTSASAAAYAAKAGMTCAVLIPQGKI
AMGKLAQAVMHGAKIIQVQGNFDDCLELARKTTAEFPTIGLVNSVNPVRIEGQKTAAFEI
MDVLGKAPDVHALPVGNAGNITAYWRGYSEYYADGLTTVKPRMLGVQAAGAAPLVNGAPV
KDPETIATAIRIGSPASWNGAVAAKEESNGAFRAATDEKILEAYRLIAATEGVFVEPASA
ASVAGLLAARAEGWLEPGLTVVCTVTGNGLKDPDTALKGMPNVEPIGVDPVAVAAALELA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcatcgtcaaccccgtccacaaggcatggccgggtctcatcgaggcataccgg
gaccgtctcgcgatcggtgacaactggaagaccgtcaccctgcgcgaaggcggcaccccg
ctcctgccggccggccacctctccgagatcaccggctgcgacgtctacctcaaggtcgag
ggtctcaaccccaccggttccttcaaggaccgcggcatgacgatggccgtcaccgacgcc
ttggcccgtggccagcgcgcagttctgtgcgcgtccaccggcaacacctccgcctcggcc
gctgcgtatgcagccaaggcaggcatgacctgcgccgtgctcatcccgcagggcaagatc
gccatgggcaagcttgcgcaggcagtcatgcacggcgccaagatcattcaggtccagggt
aacttcgacgactgcctcgaactggcacgcaagaccacggcggaattccccaccatcggt
ctggtcaactccgtcaacccggtgcgcatcgaaggtcagaagaccgcggcattcgagatc
atggacgtgctcggcaaggctcccgacgtgcacgctctcccggtcggaaacgcaggaaac
atcaccgcgtactggcgcggatactccgagtactacgcggacggtctgaccacggtcaag
ccccgcatgctcggcgtccaggcagccggtgcggctccgctggtcaacggcgcacccgtc
aaggaccccgaaaccatcgctaccgcaatccgaatcggttcccccgcttcctggaacggc
gctgtcgccgcgaaggaagagtcgaacggtgcattccgtgccgccaccgacgagaagatc
ctcgaggcttaccgtctgatcgccgccaccgagggcgtcttcgtcgaaccggcgtcggca
gccagtgtcgccggcctgctcgccgcacgtgcagagggctggctcgagccgggcctgacc
gtcgtgtgcacggtgaccggtaacggcctcaaggatcctgacacggctttgaagggtatg
ccgaacgtcgagccgatcggtgtcgatcccgttgccgtcgcggctgccctcgagcttgca
tag

DBGET integrated database retrieval system