KEGG   Rhodococcus erythropolis PR4: RER_39210Help
Entry
RER_39210         CDS       T00881                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RER_39210 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RER_39210 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RER_39210 (thrC)
Enzymes [BR:rer01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RER_39210 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(4301462..4302544)
Genome map
AA seq 360 aa AA seqDB search
MTGIVNPVHKAWPGLIEAYRDRLAIGDNWKTVTLREGGTPLLPAGHLSEITGCDVYLKVE
GLNPTGSFKDRGMTMAVTDALARGQRAVLCASTGNTSASAAAYAAKAGMTCAVLIPQGKI
AMGKLAQAVMHGAKIIQVQGNFDDCLELARKTTAEFPTIGLVNSVNPVRIEGQKTAAFEI
MDVLGKAPDVHALPVGNAGNITAYWRGYSEYYADGLTTVKPRMLGVQAAGAAPLVNGAPV
KDPETIATAIRIGSPASWNGAVAAKEESNGAFRAATDEKILEAYRLIAATEGVFVEPASA
ASVAGLLAARAEGWLEPGLTVVCTVTGNGLKDPDTALKGMPNVEPIGVDPVAVAAALELA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcatcgtcaaccccgtccacaaggcatggccgggtctcatcgaggcataccgg
gaccgtctcgcgatcggtgacaactggaagaccgtcaccctgcgcgaaggcggcaccccg
ctcctgccggccggccacctctccgagatcaccggctgcgacgtctacctcaaggtcgag
ggtctcaaccccaccggttccttcaaggaccgcggcatgacgatggccgtcaccgacgcc
ttggcccgtggccagcgcgcagttctgtgcgcgtccaccggcaacacctccgcctcggcc
gctgcgtatgcagccaaggcaggcatgacctgcgccgtgctcatcccgcagggcaagatc
gccatgggcaagcttgcgcaggcagtcatgcacggcgccaagatcattcaggtccagggt
aacttcgacgactgcctcgaactggcacgcaagaccacggcggaattccccaccatcggt
ctggtcaactccgtcaacccggtgcgcatcgaaggtcagaagaccgcggcattcgagatc
atggacgtgctcggcaaggctcccgacgtgcacgctctcccggtcggaaacgcaggaaac
atcaccgcgtactggcgcggatactccgagtactacgcggacggtctgaccacggtcaag
ccccgcatgctcggcgtccaggcagccggtgcggctccgctggtcaacggcgcacccgtc
aaggaccccgaaaccatcgctaccgcaatccgaatcggttcccccgcttcctggaacggc
gctgtcgccgcgaaggaagagtcgaacggtgcattccgtgccgccaccgacgagaagatc
ctcgaggcttaccgtctgatcgccgccaccgagggcgtcttcgtcgaaccggcgtcggca
gccagtgtcgccggcctgctcgccgcacgtgcagagggctggctcgagccgggcctgacc
gtcgtgtgcacggtgaccggtaacggcctcaaggatcctgacacggctttgaagggtatg
ccgaacgtcgagccgatcggtgtcgatcccgttgccgtcgcggctgccctcgagcttgca
tag

DBGET integrated database retrieval system