KEGG   Rhodococcus erythropolis PR4: RER_39270Help
Entry
RER_39270         CDS       T00881                                 

Gene name
xfp
Definition
xylulose-5-phosphate/fructose-6-phosphate phosphoketolase (EC:4.1.2.22 4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RER_39270 (xfp)
Enzymes [BR:rer01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     RER_39270 (xfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(4308728..4311097)
Genome map
AA seq 789 aa AA seqDB search
MTDHHYSEDQLALDLKWWAAANYLTVAQIYLKDNTLLREPLRAEHIKPRLLGHWGTSPGL
SMIYTLLNRHIVATDADWLYVTGPGHGGPALVASTYLEGTYSEIYPEVSDDAEGIHRMCR
RFSAPGGVPSHVSVQTPGSIHEGGELGYALAHAAGAAFDHPNLVVACVIGDGEAETGPLS
GSWKLPAFLNPRRDGAVLPILHVNGAKIAGPTVYGRSSDEDIQAYLGGQGWAPIVVSGDD
PDVVFPQLYQAISQAHEKIREMQGAARRGDEWTGSWPAIVLRTPKGWTGPHTVDGILVEG
THRAHQVPLSGVRTNESHLRQLEEWMRSYRPDELFDANGSLAAELAALSPAGDKRMGSTP
YANGGRLRVDLPMPPLEKYALPIQSPGSTFHETTRVLGELLRDIYAATETEDSGGIFRLF
CPDETSSNRLGAVFETTDRCWQLPITDYDDGLSADGRVMEVLSEHLCEGWLEGYLLSGRH
GMFASYEAFAMVSVSMLIQHAKWLQHAVDLPWRASVASLNVLLTSTCWRNDHNGFSHQGP
GMIDAVIPLAPSVIRVWLPPDSNTLLSISDHCLRSTDHVNLIVVDKQPHLQYLTLEQAHE
HCAAGASVWEWAGTEARGQEPDVVLAAAGDVPTQEILAAAQLLRDHTPELITRVVNVVDL
MALLTPTEHPHGFGERVFLDLFTAQTDVVFAFHGYSRAVHELIHGRPSPERFHVRGFSEQ
GTTTTPFDMVVLNKMSRYHLVIEALRRSKRRPAGASELAEFCRTQLEKHSRYIVEHLEDM
PEVENWTWS
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcaccactattccgaagaccagctcgcgctcgacctgaagtggtgggcagcg
gccaactacctgaccgttgcgcagatctatctgaaagacaacacgcttctgcgggaaccg
ttgcgagccgagcacatcaagcctcgactgctcggacactgggggaccagccctggcctg
tcgatgatctacacgctcctcaatcggcacatcgtcgccactgatgctgactggctgtac
gtcacgggcccggggcacggcggcccggcgctggtcgcgtcgacgtatctcgagggaacg
tattcggagatctatccggaagtctcggacgacgccgagggtatccaccggatgtgtcgg
cgattctcggctcccggcggagtgcccagccatgtgagtgtgcagacacccggaagcatc
cacgaaggcggcgagctcggctacgcccttgcacatgcggccggcgctgccttcgatcat
ccgaacctcgtggtggcctgtgtgatcggcgacggcgaagcggagaccgggccgttgtcc
ggctcgtggaagctcccggcgttcctcaatccacgacgcgacggcgcggtgttgccgatc
ctgcacgtgaacggcgccaagatcgcgggcccgaccgtgtacgggcgcagcagcgacgag
gacattcaggcctacctcggcggccaggggtgggcgccgatcgtcgtctccggtgacgac
cccgacgtcgtgtttcctcagttgtatcaagcgatctcgcaggcacacgagaagatccgc
gagatgcagggtgccgcacgccgcggcgacgagtggacgggttcgtggccggcaatagtc
ttgcggacgccgaaaggatggaccggtccgcacaccgtcgacggaatcttggtcgagggc
acacatcgtgcgcaccaggtgccgttgtccggcgtgcgaaccaacgaatcgcatctgcgg
caactcgaagagtggatgcggtcgtaccgtccggacgagttgttcgacgccaacggatca
ctggccgcggaactggcggcgctctcgccggcgggggacaaacgcatggggagcactccc
tacgcgaacggtgggcgacttcgcgtcgatctcccgatgccgccgctcgaaaagtacgcg
cttcccatccaatccccgggttcgaccttccacgagacgacacgagttctcggcgagctt
ctgcgcgacatctacgccgccacggaaaccgaggacagcggcgggatcttccgactcttc
tgtccggacgagacgtcgagcaatcgcctcggcgccgtgttcgagacaaccgaccgctgc
tggcaactgccgatcaccgactacgacgacgggctgtccgcggacggtcgtgtcatggag
gtcctcagcgagcacctctgcgagggttggctcgagggctatctgttgtccggtcgacac
gggatgttcgcgagctacgaagcgtttgcgatggtgagtgtgtcgatgctcatccagcac
gccaagtggctccaacatgccgtcgacctgccgtggcgggcgtccgtcgcttcgctcaac
gtgctgctgaccagtacatgctggcgcaacgaccacaacggattcagtcatcagggcccc
ggcatgatcgacgccgttattccattggcacccagtgtgatccgcgtgtggctaccgccg
gactccaacaccttgctctcgatctcggaccactgcctgcgtagtaccgaccacgtcaac
ctgatagtcgtggacaagcaaccgcacctgcaatacctcacgctcgagcaagcgcacgag
cactgcgcggcgggcgcttcggtgtgggaatgggccggaaccgaagcacgcggacaggaa
ccggacgtggtcctggccgctgcgggagatgtgccgacgcaggagatcctggctgctgca
cagttgctgcgcgatcacacgccagaactgatcacccgcgtcgtcaacgtcgtcgatctg
atggccctgctgacgccaaccgagcatccccacggatttggggagcgtgtcttcctcgat
ttgttcaccgcgcagaccgacgtcgtgttcgcattccacggatactcgcgtgcggtgcac
gaactgattcacgggcgtccgagtcccgaacgcttccacgttcgcggattcagtgaacag
ggaacaaccacaacaccgttcgacatggttgtcctcaacaagatgagccgctaccacctg
gtgatcgaggcgctacgacgctccaagcgtcggccggccggggcgtccgagttggcggag
ttctgccgcacacagctcgaaaagcactcgcgttacatcgtcgagcacctcgaagacatg
ccggaggtagaaaactggacctggtcctga

DBGET integrated database retrieval system