KEGG   Rhodococcus erythropolis PR4: RER_39340Help
Entry
RER_39340         CDS       T00881                                 

Definition
(GenBank) putative epoxide hydrolase
  KO
K10533  limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
rer00903  Limonene and pinene degradation
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RER_39340
Enzymes [BR:rer01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     RER_39340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LEH SnoaL_2 SnoaL SnoaL_3 SnoaL_4 DUF4440 NTF2 IFT46_B_C
Motif
Other DBs
NCBI-ProteinID: BAH34642
NITE: RER_39340
UniProt: C1A207
Position
complement(4319215..4319586)
Genome map
AA seq 123 aa AA seqDB search
MTPDKLITDFCALWAAADVAKIVDYFTDDVVYHNIPMEPVVGREAVRAFIEQFVGAFGNI
DFQIKRQVADGNTVMNERVDVFTINGAEVALPVMGVFEVEDGKIKAWRDYFDIAPINAAA
GQA
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgacaccggacaagctgatcaccgatttctgcgcgctgtgggcggccgccgatgttgca
aagatcgtcgactacttcaccgatgacgtcgtttatcacaacattccgatggagcccgtg
gtcggtcgcgaggccgtccgggcgttcatcgagcagtttgtcggtgccttcggcaacatc
gactttcagatcaagcgtcaggtcgcggacggcaacaccgtcatgaacgagcgcgtcgac
gtcttcaccatcaacggcgccgaggtagcgctcccggtcatgggggtattcgaagtcgag
gacggaaagatcaaagcctggcgcgactatttcgacattgcaccgatcaacgcggcagcc
ggccaggcctga

DBGET integrated database retrieval system