KEGG   Rhodococcus erythropolis PR4: RER_39350Help
Entry
RER_39350         CDS       T00881                                 

Gene name
cysQ
Definition
putative 3'-phosphoadenosine-5'-phosphatase (EC:3.1.3.-)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RER_39350 (cysQ)
Enzymes [BR:rer01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     RER_39350 (cysQ)
Transfer RNA biogenesis [BR:rer03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    RER_39350 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(4319583..4320737)
Genome map
AA seq 384 aa AA seqDB search
MSESTHSRIADEALAAELAQAAGAILLGIRAEGLGVDDGRELGRRGDKAADSYILDRLAA
ERPGDAVLSEESADDRSRLDAARVWIIDPLDGSKEYGLPNHADWAVHVALWERGSGITAA
AVAQPALGAVYSSGDEADSVPANSPLRVVVSGSRPPAFTEAVAAELGADVVHMGSAGAKA
MAVVRGEVDAYLHAGGQWEWDSAAPVGVAQAAGLHCSRIDGSPLLYNESHPYLPDLVICR
PELAESILGAIAKHSTESAVSGRVAMAREYVNALLTHDATKVRFATDAWRVENGQRTGDT
GAFISNELEQGQQYRGIVAIRELALREWGESVVARYLLDLGTPGQAPAVTVFVTEYFGIP
AGEIESILAIIEPYENDSKEAGTQ
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaatccacacacagcagaatcgccgacgaggcactcgcggcggaattggcgcag
gccgctggtgcgatcctcctggggatccgagccgagggcctgggtgtcgacgacggtcgt
gagctgggtcgccggggcgacaaggccgccgattcctacatcctcgaccggttggctgcc
gagcggccgggcgatgccgtgctctcggaggaatctgccgacgatcgcagtcgtctggat
gcagctcgggtctggatcatcgatccgctggacggctccaaggaatacggcttgcccaat
cacgcggattgggcagtgcacgtggcgctttgggagcgcggtagcggaattaccgcagcc
gcggttgctcagccggcgctcggagcggtgtactccagtggcgacgaggccgattcggtt
cccgcgaattcgccgctccgcgtagtagtcagcggatcgcgaccgcccgcattcaccgag
gcggtggcagccgaactcggcgccgacgtggtgcacatgggatcggccggcgccaaggcg
atggcggtggtgcgaggcgaggtcgacgcctacctgcatgccggtgggcagtgggaatgg
gattcggccgcacccgtcggcgtcgcacaggcggccgggctgcattgcagccgcatcgac
ggttcgccgctgctctacaacgaatctcacccctaccttccggatctcgtgatctgccga
ccggagttggctgagtcgatcctgggtgcaattgccaagcactccacggagtctgcggtc
agtgggcgcgtcgccatggcgcgtgaatacgtgaacgcattgctcactcacgacgcaacg
aaggtccgattcgcaactgacgcctggcgggtcgagaacggtcagcgaaccggtgacacc
ggcgcgttcatcagcaacgagctcgaacaggggcagcaatatcgcggaatcgtggcgata
cgtgaactcgcgctgcgtgagtggggcgagagcgtcgtcgcgcggtatctgctcgacctc
ggaacacctggccaggcaccggccgtcacagttttcgtcaccgagtacttcgggataccg
gcaggcgagatcgaaagcatcctggcaatcatcgaaccctacgaaaacgattcgaaagag
gctggaacacaatga

DBGET integrated database retrieval system