KEGG   Rhodococcus erythropolis PR4: RER_39940Help
Entry
RER_39940         CDS       T00881                                 

Definition
putative dihydrolipoamide acyltransferase (EC:2.3.1.-)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RER_39940
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RER_39940
   00020 Citrate cycle (TCA cycle)
    RER_39940
   00620 Pyruvate metabolism
    RER_39940
Enzymes [BR:rer01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RER_39940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
4377485..4378720
Genome map
AA seq 411 aa AA seqDB search
MSTGHEFRLPDLGEGLTSADLVEWTVGVGDTVELNQVLAQVETAKALVELPSPYVGVVRE
LLVEPGSTVPVGTPIIRIEEPADSPSPSDSQSPSVLVGYGPAAERPSRRRNRVTPHSQTA
ASTERRPATPSARRAAREAGIDLSEITGSGFDGAVTAADVADALRVKAASNEAPRPAGSG
MQKQPVSSGMRKQMASAMVASTRAPQASVFLTADVTPSMELLGRLRPSDAFTGLSLTPLT
LAAKALVTAISSHPMVNAHWDEARGDAVIDDHVNLGIAVASERGLSVPNIKSAETLSLVQ
LARAVTELTVAARAGVTDVHHLTGGTVTITNVGVFGVDGGIPLLNPGEAVILCLGTVSER
PWVIERKIEARSVATLTLTFDHRILDGEQAARFLSFVAQMLADPDLLLSHL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgagtacagggcacgaattccggttgccggatctcggcgagggcctgacgtccgccgat
ctggtcgagtggacggtcggcgtcggcgacacggtggaactcaatcaagttctcgcccag
gtagagacagccaaggctctcgtcgaactgccgtcgccctacgtcggcgttgtcagagaa
ctcctcgtcgaacctggctctaccgtcccggtcggcactccgatcatccgtatcgaggag
cctgcagattcaccgtctccaagtgattcacagtctccgagcgtgcttgtcggatacgga
cccgcggccgagagaccgagccgacgacggaaccgggttacgccacactcgcaaaccgcg
gcgagtaccgagcgtcggcccgcaacaccctcggcgcggcgcgcggcccgcgaagccggc
atcgatctgagcgaaatcaccggaagtggattcgacggtgccgtcacggcagcggacgtc
gcagacgcgcttcgcgtgaaggccgcgtcgaatgaagctccgcggccggccggatccggt
atgcagaaacagccggtctcgtccggcatgcggaaacagatggcgtcggcgatggtcgcc
agtacccgtgcccctcaggccagcgtcttcctcaccgccgatgtcacgccttcgatggaa
ctactcggcaggctccgtccctcggacgcattcaccggactttctctcactccgctgact
ctcgcggccaaggccttggttacggcgatctcgtcgcacccgatggtgaacgcgcattgg
gacgaggcccgcggcgacgccgtcatcgacgatcacgtgaatctcggcatcgccgtcgcc
tccgaacgtggactgtccgtgcccaacatcaaaagcgccgagacgctgagcctggtccaa
cttgcacgcgcggtgaccgaactgaccgtcgctgcccgcgcgggagtgaccgatgtccat
cacctgaccggtggcaccgtcacgatcaccaatgtcggagtcttcggcgtcgacgggggc
attccgctcctcaatccgggagaagccgtcatcctttgcctgggcacagtgagcgagcgt
ccctgggtaattgagcgcaagatcgaagcgcggagcgtcgcgacactgacgttgacgttc
gaccaccggatactcgatggtgagcaggccgcgagattcctctcatttgtcgcacagatg
ctcgcggacccggacctgttgctgtctcacctgtaa

DBGET integrated database retrieval system