KEGG   Rhodococcus erythropolis PR4: RER_41090Help
Entry
RER_41090         CDS       T00881                                 

Gene name
echA
Definition
(GenBank) probable enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
rer00071  Fatty acid degradation
rer00280  Valine, leucine and isoleucine degradation
rer00281  Geraniol degradation
rer00310  Lysine degradation
rer00360  Phenylalanine metabolism
rer00362  Benzoate degradation
rer00380  Tryptophan metabolism
rer00410  beta-Alanine metabolism
rer00627  Aminobenzoate degradation
rer00640  Propanoate metabolism
rer00650  Butanoate metabolism
rer00903  Limonene and pinene degradation
rer00930  Caprolactam degradation
rer01100  Metabolic pathways
rer01110  Biosynthesis of secondary metabolites
rer01120  Microbial metabolism in diverse environments
rer01130  Biosynthesis of antibiotics
rer01212  Fatty acid metabolism
Module
rer_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RER_41090 (echA)
   00650 Butanoate metabolism
    RER_41090 (echA)
  Lipid metabolism
   00071 Fatty acid degradation
    RER_41090 (echA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RER_41090 (echA)
   00310 Lysine degradation
    RER_41090 (echA)
   00360 Phenylalanine metabolism
    RER_41090 (echA)
   00380 Tryptophan metabolism
    RER_41090 (echA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RER_41090 (echA)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RER_41090 (echA)
   00281 Geraniol degradation
    RER_41090 (echA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RER_41090 (echA)
   00627 Aminobenzoate degradation
    RER_41090 (echA)
   00930 Caprolactam degradation
    RER_41090 (echA)
Enzymes [BR:rer01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RER_41090 (echA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: BAH34817
NITE: RER_41090
UniProt: C1A2I2
Position
complement(4521141..4521902)
Genome map
AA seq 253 aa AA seqDB search
MADEVLTERRGRTLIITINRPEARNAINSAVSHALAAAVEELDADDDLSLAVLTGAGGNF
CAGMDLKAFVAGENVLVPGRGLGFTEGPPRKPIISAVEGFALAGGTELVLATDLVVASSE
AKFGIPEVKRGLVAGGGGLLRLPKRIPYQKALELALTGDSFTAEEAYRYGFVNTLTEPGK
ALDGALELADRITRNGPLAVAVTKEIIVKAGGWSDDEAFAKQLQVMAPVFASEDAREGAT
AFAEKRAPVWKGR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgaggttctcaccgagcggcgcgggcggacactgatcatcaccatcaaccgg
cccgaggcgcgtaacgccatcaactcggcggtcagtcacgcgttggccgcggcggtcgaa
gagctcgatgcggacgacgatctgtccttggccgtgctgacaggagccggcggaaacttc
tgtgccggtatggatctgaaggcattcgtggccggcgagaacgtcctcgtgccgggacgc
ggtctcggattcacggaagggccaccgcgtaagccgatcatttcggcggtcgagggcttc
gcgttggcaggcggcacggaactcgtgcttgccaccgacctggtggtggcgtcgtccgaa
gcgaagttcggtatcccggaggtcaagcgaggactggttgcaggtggcggcggattgttg
cgcctgcccaagcggattccgtaccagaaggctctggaactggcgctgaccggcgacagt
ttcaccgccgaggaggcataccgctacggcttcgtgaacacgttgaccgaaccgggcaag
gcgctcgacggcgcactggagctggctgatcgaatcacccgcaacggaccgctcgcggta
gcggtcaccaaggagatcatcgtcaaggccggcggttggtccgacgatgaagctttcgcg
aagcagttgcaggtcatggcgccggtattcgcatccgaagatgcacgcgagggtgcgacg
gcgttcgccgagaagcgcgccccggtctggaaggggcggtaa

DBGET integrated database retrieval system