KEGG   Rhodococcus erythropolis PR4: RER_41870Help
Entry
RER_41870         CDS       T00881                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RER_41870
Enzymes [BR:rer01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     RER_41870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(4603054..4603899)
Genome map
AA seq 281 aa AA seqDB search
MAEDDLAGATIALTAERRVEEFATLLERRGAEIVRTPVIHVLPLVDDRDLRTQTSALIAD
PPELVVISTGIGFRGWLDAVASWGLTDEFLGALARTRIIARGPKATGAIRGAGLREEWSP
SGESSEEVLEHLGSEGVAGLRVAVQLHGTITEWEPLTDLSASLADIGAVVTPVSVYRWIR
PPDQSPVRALVAAVRSGAIDALTFTSAPAVSSMLSTAKEMGELERFVAAMRGPVPTYCVG
PVTAAPLELLGVPTIQPERSRLGSLARLIIDDLPKRRHRPE
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaagatgatctggcgggcgcgactatcgccttgaccgcagaacggcgtgtcgaa
gaatttgcgacgctcctcgaacgtcgaggcgcggagatcgtgcggacaccggtgatccat
gtgctgccgttggtggacgatcgggacctgcgcactcagacgtccgcgttgattgccgat
ccgccggaattggtcgtgatcagcaccggaatcggctttcggggttggctcgacgccgtc
gcgtcgtggggtttgaccgacgagttcctcggagctctggcccggacgcgcatcatcgcc
cgcggccccaaggcgacgggcgccatccggggcgccggactgcgcgaggaatggtcgcct
tcgggtgagtcgtccgaggaagttctggaacacctcggaagcgagggagtggcaggctta
cgcgtcgcggtccagttgcacggcaccatcaccgaatgggagccgttgacggacctgagc
gcctccctcgccgacatcggcgcggttgtcaccccggtgtcggtctatcggtggatccgg
ccgccggatcagtcgccagtccgcgcgttggtcgctgcagttcgttccggtgcaatcgac
gcgctgaccttcaccagtgcccccgcggtgtcctcgatgctcagcacggcaaaagagatg
ggcgagctggagcggttcgtcgcagctatgcgcggaccggtaccgacctactgcgtcgga
ccggtgacggccgccccgctggaactcctcggtgttccgaccatccagccggagcgatcg
cgtctcggttcgctggcgaggctcatcatcgacgacctgcccaaacgtcgccaccgcccg
gagtga

DBGET integrated database retrieval system