KEGG   Rhodococcus erythropolis PR4: RER_42470Help
Entry
RER_42470         CDS       T00881                                 

Definition
hypothetical protein
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RER_42470
Enzymes [BR:rer01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     RER_42470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
4663202..4663627
Genome map
AA seq 141 aa AA seqDB search
MSSSTATVNAMFAALTDFDVDAAAELMTDDIVWQNVSLPTLRGKKTVVRALRLVTKPSLK
FEAEMHHIVGDESTVLTERTDILTVGPLRIEFWVCGTFELRDGKVSVWRDYFSLRDVAWG
VVTAVGRAVVGSGTRSRLAPA
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgagtagttcgacagccacggtgaacgcaatgttcgcggccctcaccgatttcgacgtg
gacgcagcagcggaattgatgacagacgacatcgtctggcagaacgtctcgctccccaca
ctgcgaggcaagaagaccgtcgtgcgagcgcttcgtctggtcaccaagccttcactgaaa
ttcgaggccgagatgcaccacatcgtcggcgacgagtccacggtgctcaccgaacgcacc
gacatcctgaccgtcgggccgctgcgcatcgaattctgggtgtgcggaactttcgaactg
cgcgacggcaaggtctccgtctggcgtgactacttcagtctgcgagacgtcgcgtggggt
gtggtgaccgcggtcggccgtgcagtcgtcgggagcgggacacgaagtaggcttgctccg
gcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system