KEGG   Rhodococcus erythropolis PR4: RER_42650Help
Entry
RER_42650         CDS       T00881                                 

Gene name
metB
Definition
probable cystathionine gamma-synthase/cystathionine gamma-lyase (EC:2.5.1.48 4.4.1.1)
Orthology
K01739  
cystathionine gamma-synthase [EC:2.5.1.48]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Cysteine and methionine metabolism
Selenocompound metabolism
Sulfur metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RER_42650 (metB)
  Energy metabolism
   00920 Sulfur metabolism
    RER_42650 (metB)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    RER_42650 (metB)
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    RER_42650 (metB)
Enzymes [BR:rer01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     RER_42650 (metB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(4681784..4682956)
Genome map
AA seq 390 aa AA seqDB search
MSEQRSKADNISWQGFSTKAVHAGYEPDPLTGAVNVPIYASSTFAQDGVGGMRSGFEYAR
TGNPTRRPLEANLAALESGTYGRAFSSGMAATDCLLRSVLRPGDHLVIPDDAYGGTFRLI
DKVFTQWGIEYTPAPVSDVDAVRAAMKSNTKLVWVETPTNPLLNIGDIELLAEVAHEGNA
KIVVDNTFASPYLQQPLQLGADIALHSTTKYIGGHSDVVGGALVCNDEELDTAFAFLQNG
SGGVPGPFDAFLTLRGIKTLALRMERHSDNAEKVVELLDGHPAVASVIYPGLASHPSHKV
AAKQMRRFGGMISVRLKGGKAAALDLCSRTEIFTLAESLGGVESLIEFPGAMTHASTAGS
ALEVPDDLVRLSVGIEDASDLVGDIEQALS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagcaacgcagcaaggccgacaacatcagctggcagggtttctccacgaaagcg
gtgcatgcgggttacgaacccgatccgctgaccggcgcggtcaacgtgccgatctacgca
agttccaccttcgcccaagacggcgtcggtggaatgcgcagtggcttcgagtacgcgcga
acgggcaaccccacccgtcgcccgctcgaggcgaaccttgccgcgctcgaatccggaacc
tacggccgagcgttcagttcgggaatggcggccaccgactgcctgctccgttcggtactt
cgaccgggcgatcacctggtcatccccgacgacgcgtatggcggaaccttccgtctcatc
gacaaggtgttcacgcagtgggggatcgagtacaccccggctccggtgtccgacgtcgat
gcggtgcgcgcggcgatgaagtccaacaccaagctggtctgggtcgagacgcccacgaac
ccgctgctcaatatcggtgacatcgagctccttgccgaggtcgcccacgagggcaacgca
aagatcgtggtggacaacaccttcgcgtcgccgtacctgcagcagccgctgcagctcggt
gccgacatcgcgctgcactccacgaccaagtacatcggcggacactccgacgtggtcggt
ggcgctctcgtctgcaacgacgaagaactggataccgcgtttgccttcctgcagaacgga
tccggcggcgttcccggcccgttcgacgcgttcctgacgttgcgcggaatcaagacactg
gcgctgcgcatggagcgtcacagtgacaacgcggagaaggtcgtcgaattgctcgacggc
caccccgcggttgccagcgtcatctacccgggcctggcttcgcatccgtcacacaaggtc
gcggccaagcagatgcgacgcttcggcggcatgatctccgtccgcctcaagggcggcaag
gcggcagctctcgacctgtgctcgcgcaccgagatcttcacgctggcagaatctctcggc
ggcgtcgaatctctcatcgagttccccggcgcgatgacccacgcctcgacggccggttcc
gctctcgaggttcccgacgatctggttcgcctgtcggtcggcatcgaagacgcctccgat
ctggtcggcgacatcgagcaagcgctgtcctga

DBGET integrated database retrieval system