KEGG   Rhodococcus erythropolis PR4: RER_42650Help
Entry
RER_42650         CDS       T00881                                 

Gene name
metB
Definition
probable cystathionine gamma-synthase/cystathionine gamma-lyase (EC:2.5.1.48 4.4.1.1)
Orthology
K01739  
cystathionine gamma-synthase [EC:2.5.1.48]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Cysteine and methionine metabolism
Selenocompound metabolism
Sulfur metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RER_42650 (metB)
  Energy metabolism
   00920 Sulfur metabolism
    RER_42650 (metB)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    RER_42650 (metB)
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    RER_42650 (metB)
Enzymes [BR:rer01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     RER_42650 (metB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(4681784..4682956)
Genome map
AA seq 390 aa AA seqDB search
MSEQRSKADNISWQGFSTKAVHAGYEPDPLTGAVNVPIYASSTFAQDGVGGMRSGFEYAR
TGNPTRRPLEANLAALESGTYGRAFSSGMAATDCLLRSVLRPGDHLVIPDDAYGGTFRLI
DKVFTQWGIEYTPAPVSDVDAVRAAMKSNTKLVWVETPTNPLLNIGDIELLAEVAHEGNA
KIVVDNTFASPYLQQPLQLGADIALHSTTKYIGGHSDVVGGALVCNDEELDTAFAFLQNG
SGGVPGPFDAFLTLRGIKTLALRMERHSDNAEKVVELLDGHPAVASVIYPGLASHPSHKV
AAKQMRRFGGMISVRLKGGKAAALDLCSRTEIFTLAESLGGVESLIEFPGAMTHASTAGS
ALEVPDDLVRLSVGIEDASDLVGDIEQALS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagcaacgcagcaaggccgacaacatcagctggcagggtttctccacgaaagcg
gtgcatgcgggttacgaacccgatccgctgaccggcgcggtcaacgtgccgatctacgca
agttccaccttcgcccaagacggcgtcggtggaatgcgcagtggcttcgagtacgcgcga
acgggcaaccccacccgtcgcccgctcgaggcgaaccttgccgcgctcgaatccggaacc
tacggccgagcgttcagttcgggaatggcggccaccgactgcctgctccgttcggtactt
cgaccgggcgatcacctggtcatccccgacgacgcgtatggcggaaccttccgtctcatc
gacaaggtgttcacgcagtgggggatcgagtacaccccggctccggtgtccgacgtcgat
gcggtgcgcgcggcgatgaagtccaacaccaagctggtctgggtcgagacgcccacgaac
ccgctgctcaatatcggtgacatcgagctccttgccgaggtcgcccacgagggcaacgca
aagatcgtggtggacaacaccttcgcgtcgccgtacctgcagcagccgctgcagctcggt
gccgacatcgcgctgcactccacgaccaagtacatcggcggacactccgacgtggtcggt
ggcgctctcgtctgcaacgacgaagaactggataccgcgtttgccttcctgcagaacgga
tccggcggcgttcccggcccgttcgacgcgttcctgacgttgcgcggaatcaagacactg
gcgctgcgcatggagcgtcacagtgacaacgcggagaaggtcgtcgaattgctcgacggc
caccccgcggttgccagcgtcatctacccgggcctggcttcgcatccgtcacacaaggtc
gcggccaagcagatgcgacgcttcggcggcatgatctccgtccgcctcaagggcggcaag
gcggcagctctcgacctgtgctcgcgcaccgagatcttcacgctggcagaatctctcggc
ggcgtcgaatctctcatcgagttccccggcgcgatgacccacgcctcgacggccggttcc
gctctcgaggttcccgacgatctggttcgcctgtcggtcggcatcgaagacgcctccgat
ctggtcggcgacatcgagcaagcgctgtcctga

DBGET integrated database retrieval system