KEGG   Rhodococcus erythropolis PR4: RER_43890Help
Entry
RER_43890         CDS       T00881                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RER_43890 (galU)
   00052 Galactose metabolism
    RER_43890 (galU)
   00500 Starch and sucrose metabolism
    RER_43890 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    RER_43890 (galU)
Enzymes [BR:rer01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     RER_43890 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(4822682..4823593)
Genome map
AA seq 303 aa AA seqDB search
MTDVVASSTRAFRTAVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAGEAADSGAER
LVIVTSPGKDGVVAHFVEDLVLESKLEASGKLAALAKVRKAPGLLEVDSVIQEQPLGLGH
AVGCVESVLDDDEDAIAVLLPDDLVLPRGVLEIMARVRAKRGGSVLCAIDVPKDAVSAYG
VFDVEIVPDAVNPDVLKVVGMVEKPAVEDAPSTFAAAGRYLLDRAIFDALRRIKPGAGGE
LQLTDAIALLISEGHPVHVVVHRGTRHDLGNPGGYLRASVDLALDSDDYGPSLRKWLADR
LDR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgttgtcgctagcagcacgagggccttccgtacggccgtggttcccgcagcc
ggacttggtacgcgtttcctgcctgccaccaagacggttccgaaagaattgctgccggtc
gtggacacaccgggtatcgaactggtggcgggtgaagctgcggactcgggagccgagcgg
ctcgtcatcgtgacgtccccgggcaaagacggagtggttgcgcacttcgtcgaggatctc
gtgctcgaaagcaagctggaagcgagcggaaaacttgctgccctggcaaaggtgcgcaaa
gcgccgggtttgctcgaagtcgattccgtgattcaggagcagcccctcggcctcgggcat
gcagtcggttgcgtcgagtcggttctcgacgacgacgaagatgccatcgcggtccttctg
cccgatgatcttgtactcccgcgtggcgtcctggagatcatggcgcgagttcgggccaag
cgcggcgggtccgttctctgtgcaatcgacgttcccaaggacgcagtgagcgcttacggc
gtcttcgacgtcgagatcgttcccgacgcggtcaatcccgacgtcctcaaggtcgtcggc
atggtcgagaagccggctgtggaagacgcgccgtcgacctttgccgctgcgggtcgctat
ctgctcgatcgtgcgatcttcgacgcactccgccgcatcaagccgggagccggcggtgag
ttgcaactcaccgacgccatcgctcttctgatttccgagggtcatccggttcacgtggtg
gtgcaccgcggaacgcgtcatgacctgggcaaccccggcgggtacctccgcgcttcggtt
gacctggcactcgacagtgacgattacggtccgtctttgcgtaagtggctcgcggatcgg
ctcgaccgctga

DBGET integrated database retrieval system