KEGG   Rhodococcus erythropolis PR4: RER_44290Help
Entry
RER_44290         CDS       T00881                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
rer00020  Citrate cycle (TCA cycle)
rer00640  Propanoate metabolism
rer00660  C5-Branched dibasic acid metabolism
rer01100  Metabolic pathways
rer01110  Biosynthesis of secondary metabolites
rer01120  Microbial metabolism in diverse environments
rer01130  Biosynthesis of antibiotics
rer01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RER_44290 (sucC)
   00640 Propanoate metabolism
    RER_44290 (sucC)
   00660 C5-Branched dibasic acid metabolism
    RER_44290 (sucC)
Enzymes [BR:rer01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     RER_44290 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-ProteinID: BAH35137
NITE: RER_44290
UniProt: C1A3F2
Position
complement(4858483..4859652)
Genome map
AA seq 389 aa AA seqDB search
MDLFEYQAKELFAKHGVPTSAGRVTDTVAGAREIAEEIGKPVMVKAQVKVGGRGKAGGVK
YSPDVDAAVANAEAILGLDIKGHVVKKLLVAEASDIAEEYYISFLLDRTNRTYLAMCSVE
GGVEIEVTAEENPDALAKIPVDAVKGVDLAFARSIAEAGKLPAEVLDAAAVTIQKLWEVF
INEDALLVEVNPLVRTPDDQILALDGKVTLDENAAFRQPGHEAFEDRDATDPLELKAKEN
DLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGENHGGVKPANFLDIGGGASAAVMAAGLD
VILNDAQVKSVFVNVFGGITACDAVANGIVGALKTLGDEANKPLVVRLDGNNVEEGRRIL
AEANHPLVTVVATMDEAADKAAELAHAAK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggatctcttcgaataccaggcgaaggaactcttcgccaagcacggagtgccgacttcg
gctggacgtgttacagacacagtcgccggcgcacgcgagattgccgaagaaatcggtaag
cccgtgatggtgaaggcacaggtcaaggtaggcggccgcggcaaggccggtggcgtcaag
tactcgcccgacgtggatgccgcagtggcaaacgccgaggcaatcctgggcctggacatc
aagggccatgtcgtcaagaagctgctggtcgcagaggcaagtgacattgccgaggagtac
tacatctccttcctgctcgaccgcaccaaccgcacctacctggccatgtgctcggtagag
ggtggcgtcgagatcgaggtcaccgccgaggagaaccccgacgctctcgccaagatcccc
gtcgacgcagtcaagggcgtcgacctcgcgttcgcgcgcagcatcgccgaggcaggaaag
ctgcccgcagaggtgctcgacgcagcggccgtcacgatccagaagctgtgggaggtcttc
atcaacgaggacgcactcctcgtcgaggtcaaccccctcgttcgtacgcctgacgatcag
atcctcgccctcgacggcaaggtcaccctcgacgagaacgcagcgttccgtcagcccggc
cacgaggcattcgaggatcgcgacgctaccgatcccctcgagctcaaggccaaggaaaac
gacctcaactacgtcaagctcgacggtgaggtcggaatcatcggcaacggcgcaggcctg
gtcatgtccaccctggacgtcgtcgcatacgccggcgagaaccacggtggcgtcaagccc
gccaacttcctcgacatcggcggcggagcttccgctgcagtcatggctgccggcctcgac
gtcatcctgaacgacgcacaggtcaagagcgtgttcgtcaacgtcttcggcggcatcacc
gcgtgtgacgcagttgccaacggcatcgtcggcgcactgaagaccctgggcgacgaggcc
aacaagccgctcgtcgttcgcctggacggaaacaacgtcgaagagggtcgtcgcatcctc
gccgaggccaaccacccgctggtcacggtcgtcgcaaccatggacgaggccgccgacaag
gccgccgaactcgctcacgcagcgaagtaa

DBGET integrated database retrieval system