KEGG   Rhodococcus erythropolis PR4: RER_44490Help
Entry
RER_44490         CDS       T00881                                 

Definition
putative sugar-phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    RER_44490
Enzymes [BR:rer01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     RER_44490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
4882094..4882879
Genome map
AA seq 261 aa AA seqDB search
MTDTMHASKQELMATAETKMLTEVTTGSWTLRQKIALTCRALSDAGHDSGLAGQISARGE
QPGTFVTQRLGLGFDEITEDNLLLVNEDLEVLDGEGMPNPANRFHSWIYRARPDVNCIVH
THPLHATALSMLEIPLVVSQMDIAPLYDDCAFLADWPGVPVGNEEGEIISAALGDKRAIL
LAHHGQLVVGNTVEEACSLGHLIERAARLQLLAMAAGDIKPLPPRLAKEAHDWTLTPRRS
EANFAYYARRALRNHPDALTN
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacacgatgcatgcgagcaagcaagaactcatggccaccgccgagacgaaaatg
ctcaccgaagtaaccacaggcagttggacacttcgacagaagatcgcactgacctgccgc
gcactgtcggacgccggccacgattccggtctcgccggccagatctccgcccgcggtgag
cagcctggcacgtttgtcacccagcgactcggcctcgggttcgacgagatcaccgaggac
aacctcctgctcgtcaacgaggacctcgaagtcctcgacggggagggcatgccgaacccc
gccaacaggttccacagttggatctaccgcgcccgacccgacgtcaactgcatcgtccac
acacacccactgcacgcgacggcgttgtcgatgctcgagattcccctcgtcgtctcccaa
atggacatcgcgcccctctacgacgactgcgcatttctcgccgactggccaggagttccc
gtgggaaacgaagagggcgagatcatttcggctgcgctcggcgacaagcgggcaattctg
ctcgcccaccacggccaactcgtcgtcggcaacacggtcgaagaagcatgctccctcggg
catctgatcgagcgggccgcgcggctgcagttgctggcaatggctgccggcgacatcaag
ccgctaccgcctcgcctggcgaaggaggctcacgattggacactgacccctcggcgcagc
gaggcgaacttcgcgtactacgcccgtcgggctctccgcaatcatcccgacgcactgacc
aactga

DBGET integrated database retrieval system