KEGG   Rhodococcus erythropolis PR4: RER_50520Help
Entry
RER_50520         CDS       T00881                                 

Gene name
phoD
Definition
probable phospholipase D (EC:3.1.4.4)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rer00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:rer00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:rer02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(5513691..5515379)
Genome map
AA seq 562 aa AA seqDB search
MHTNAFDRISRRGLLQGSAALAGAVGLGVASASHAGAEVPGGSPGFAHGVASGDPLPDAV
IIWTRITPTAEATPGSGVGPAVTLNWQVATDEGFASIVASGSVAASADSDHTAKVDVTGL
DPSTTYWYRFVAGSAVSPVGRTRTAPSNSADLDRLRFGVVSCSNWEAGYFGAYRHLAFRE
DLDAIIHLGDYIYEYGQGEYGARNGSVRLHEPAHEIISLADYRIRHAQYKTDPDLAALHL
KLPFITTWDDHESADNAYRDGAENHTPGIEGDWADRKANSAKAYFEWMPVRPSGSGSSVQ
LYRRFRFGNLAEISMLDLRTYRDEQPTMKQVDDPSRTITGRAQMDWLTSGIVTSPTQWKI
VGNPVMITPCVFPPLEPATTAALTELVGVPQAGVPYNTDQWDGYTADRTRLFDAITSNGV
DNTVFITGDIHTSWACDLPTNAANYPGGPTVGAEFVVPSVTSPNIDDMLKVPPRTVTVAA
EEAFKAVNRHVRYVELDSHGFGVFEIAREGTQMDWYYVDDLTNPQSNAHYAVSYRLPAGA
GSRVSPTSAALDQASYRPGVDQ
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
gtgcacacgaatgccttcgatcgaatatccagacgtggcctactgcagggatcggcggct
ctcgccggcgcagtaggtctcggtgtcgcttcggcgagccacgccggtgccgaggttccg
ggtggcagcccgggattcgcgcacggcgtggcatccggtgacccgttgccggatgccgtg
atcatctggacccgcatcaccccgacggcagaggcgacgcccggttccggcgtcgggccg
gcggtgacgctcaactggcaggtcgcgaccgatgaggggttcgcgagcatcgtggcgtcg
ggaagtgttgctgcttcggcggattccgatcacaccgcgaaggtcgacgtcaccggactc
gatccgtcgacgacgtactggtaccgattcgttgcgggttcggccgtttctccggtgggc
cgcacccgtacggcaccgtcgaactcggcggatctcgatcgtctccgcttcggcgtcgtg
tcctgctccaactgggaagcaggatatttcggtgcttatcgccacctcgcattccgcgaa
gacctcgacgcgatcattcatctcggtgactacatctacgagtacgggcagggggagtac
ggcgcgcggaacggatccgttcgccttcacgagccggcccacgagatcatttcgctggcc
gactaccgaattcggcacgcgcagtacaagaccgacccggatctggctgctcttcacctg
aaactcccgttcatcactacgtgggacgatcacgaatcggccgacaacgcgtaccgggac
ggcgccgaaaatcacactcccggtatcgaaggcgattgggcagatcgaaaggcgaactcg
gccaaggcatatttcgagtggatgcctgtccgcccgtcgggtagtggttcgagcgttcag
ctgtatcgacggttccgcttcgggaatctggccgagatctcgatgctcgacctgcgtacc
taccgcgacgagcagccgacgatgaagcaggtcgacgatccgtcacgcaccattaccgga
cgcgcacagatggattggttgaccagcggaatcgtcacctccccgacgcagtggaagatc
gtcggcaatccggtcatgatcacgccctgcgtgttcccgccgctggaaccggcgaccacc
gcggcgttgaccgaactggtgggagtgccgcaggccggtgtcccgtacaacacggatcag
tgggacgggtacaccgccgaccgcaccaggcttttcgatgcgatcacctcgaacggtgtg
gacaacaccgtcttcatcaccggtgacatccacacgtcgtgggcttgcgacctaccgacc
aatgccgcgaattacccaggcgggccgactgtcggcgccgagttcgtcgtcccgtcggtg
acgtcgcccaacatcgacgacatgctgaaagtgccgccgcgaacggtaaccgttgcggca
gaagaagcattcaaggcagtgaaccgacacgtgcggtacgtcgaactggattcgcacggc
ttcggcgtattcgaaatcgcccgcgaaggtactcagatggattggtactacgtcgacgat
ctcaccaatccacagagcaatgcgcactatgccgtgagctaccgtctaccggcaggcgcg
ggcagtagagtctcgcccacttcggccgccctcgatcaggcctcgtaccgaccaggagtc
gaccagtga

DBGET integrated database retrieval system