KEGG   Rhodococcus erythropolis PR4: RER_52790Help
Entry
RER_52790         CDS       T00881                                 

Definition
putative hydrolase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RER_52790
  Amino acid metabolism
   00300 Lysine biosynthesis
    RER_52790
Enzymes [BR:rer01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     RER_52790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(5740776..5741858)
Genome map
AA seq 360 aa AA seqDB search
MDSLGLLSELVALDTVSGEAAPQRRAMDSIVSLVLSRAPQAKVESDLTGNHPWALITNEA
APSAARLLFACHVDTVPVGTVSDWEFDPYAAQVDGELFLGRGTSDMKAGLVAATAAVVDA
FERGVPVALLLTSDEEIGSLGAVRSADAVANLEVGAVIVPEATGNRINLGHRGALWLEVS
VKGKAAHGSTPQRGTNAVLKLLDVVDRARRELPLSSDAFLGAETWNLGLVGGGSAPNIVP
DNARAVIDHRTVGDGADLLAWWRAQPEVDSVETSIHLGGVRTDASDPWLATLPIPVATEP
VSYFTDASVLAAAAPGAPVVIWGPGTPSLMHAANESVKVSELNDAIAAYGAVAAAWPTVD
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggattccctcggacttctctcggaactggtagctctcgacacggtctcgggggaggcc
gctcctcaacggcgggcgatggattcgattgtctcgttggttctctcacgtgcgccacag
gcgaaggtggagtcagacctgaccggcaatcatccctgggccttgatcaccaacgaagct
gcaccctcggcagccagactcctgttcgcctgccacgtggacacggtgccagtgggcact
gtctccgactgggagttcgacccgtacgccgcacaggtcgacggcgaattgttcctcggc
agagggacatcggatatgaaggccggccttgttgccgctactgccgcggttgtcgacgct
ttcgaacgtggagtcccggtcgcactactgctgacgagcgacgaggaaatcggatcgctc
ggggccgttcgttcggccgacgccgtggcgaatctcgaggtcggggctgtcatcgttccc
gaggcgaccggcaatcgcatcaacctggggcaccgcggtgcactgtggctcgaagtgtcc
gtcaaaggaaaagccgcgcacgggagtacgccgcagcgaggaactaacgctgtcctcaaa
ctgcttgacgtcgtcgatcgagctcggcgtgagcttccgctgtcgtccgacgcgtttctg
ggcgccgaaacctggaacctcggtttggtcggcggcggttcggctccgaacatcgtgccg
gacaatgcacgtgcggtgatcgatcaccgcacggtgggagacggcgcagacctgcttgca
tggtggcgcgcccaaccggaagtcgactcggtggagacgtcgattcacctgggaggtgtg
cgtaccgacgcgtcggatccgtggttggctaccttgccgatccctgttgcaaccgaaccg
gtttcgtacttcaccgacgcttcggtgctggcagcggccgcccccggcgctcccgtcgtg
atctggggccctggcactccctcgttgatgcatgcagccaacgaaagcgtcaaggtgtcc
gaactgaacgatgcgatcgctgcctacggtgccgtggctgctgcttggccgacggtggac
tga

DBGET integrated database retrieval system