KEGG   Rhodococcus erythropolis PR4: RER_54610Help
Entry
RER_54610         CDS       T00881                                 

Definition
putative 1-aminocyclopropane-1-carboxylate deaminase (EC:3.5.99.7)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:rer00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(5908050..5908994)
Genome map
AA seq 314 aa AA seqDB search
MFSSDVPPISLGSWPTPVEPLARCAKALGLGPEDLWIKRDDVTGLGGGGNKIRKLQYTCA
QALAVGATTFITTGAPQSNHARLTASAAARLGLRCVLVLGGAEPESAQGNLVLDALAGAE
IVWAGGDRASAVDAAVQAVADSGGVPFVIPFGGTSAVAAQGYVDCAREIEQQLPGVERVV
VALGSGGTMAGLVAHLGVDRVVGVDVGAVADPVSTLAGLLDEMPGPTVRAADLQILRNQV
GQGYSTLTEASAGAIRCLARTEGIFLDPTYTGRAFAGLIQLVKDKAITAGSKTVFLHTGG
LPGLFGHPELSTLR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgttcagttccgacgttccgccgatcagcctgggcagttggccgacgcccgtcgaacct
ttggcgcgttgcgcgaaggcactcggattggggccggaagacctgtggatcaaacgtgac
gatgtcaccggactaggcggtggcggcaacaagatccgaaagctgcagtacacctgcgct
caggctttggccgtcggcgcgacgacttttatcactaccggtgcaccgcaaagcaatcac
gctcggttgactgcatccgcagcagcccgtttgggattgcgttgtgtgctggtgctcggt
ggtgccgagccggaatccgcgcagggaaatctcgttctggatgcactcgcgggcgctgag
atcgtctgggccggtggggacagggcatccgcggtcgacgccgcggtgcaggccgtcgct
gactcgggcggagttccttttgtcattcccttcggtggtaccagcgcggtggccgcgcag
ggttacgtcgactgcgcacgcgagatcgagcagcaactccccggagtggaacgcgtcgtg
gttgcactcggatcgggcggaacgatggctggacttgtcgcgcatctgggcgtcgacaga
gttgtcggcgtcgatgtcggggctgttgccgatccagtgtcgaccctcgctgggttattg
gacgagatgcctggtccgaccgtgcgagccgcggatcttcagatcctgcgaaaccaagtt
ggacaaggatattcgacgctcacggaagcatcagccggcgcgatccgatgtttggctcgt
acggagggcatcttcctcgacccgacgtacaccggccgagcctttgcgggattgatccaa
ctcgtgaaggacaaagccatcacggcgggatcaaaaacggtcttcctgcacaccggtggg
ttacctggcctgttcggacatcccgaactgtcgacgctgcggtga

DBGET integrated database retrieval system