KEGG   Rhodococcus erythropolis PR4: RER_54610Help
Entry
RER_54610         CDS       T00881                                 

Definition
putative 1-aminocyclopropane-1-carboxylate deaminase (EC:3.5.99.7)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    RER_54610
Enzymes [BR:rer01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     RER_54610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(5908050..5908994)
Genome map
AA seq 314 aa AA seqDB search
MFSSDVPPISLGSWPTPVEPLARCAKALGLGPEDLWIKRDDVTGLGGGGNKIRKLQYTCA
QALAVGATTFITTGAPQSNHARLTASAAARLGLRCVLVLGGAEPESAQGNLVLDALAGAE
IVWAGGDRASAVDAAVQAVADSGGVPFVIPFGGTSAVAAQGYVDCAREIEQQLPGVERVV
VALGSGGTMAGLVAHLGVDRVVGVDVGAVADPVSTLAGLLDEMPGPTVRAADLQILRNQV
GQGYSTLTEASAGAIRCLARTEGIFLDPTYTGRAFAGLIQLVKDKAITAGSKTVFLHTGG
LPGLFGHPELSTLR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgttcagttccgacgttccgccgatcagcctgggcagttggccgacgcccgtcgaacct
ttggcgcgttgcgcgaaggcactcggattggggccggaagacctgtggatcaaacgtgac
gatgtcaccggactaggcggtggcggcaacaagatccgaaagctgcagtacacctgcgct
caggctttggccgtcggcgcgacgacttttatcactaccggtgcaccgcaaagcaatcac
gctcggttgactgcatccgcagcagcccgtttgggattgcgttgtgtgctggtgctcggt
ggtgccgagccggaatccgcgcagggaaatctcgttctggatgcactcgcgggcgctgag
atcgtctgggccggtggggacagggcatccgcggtcgacgccgcggtgcaggccgtcgct
gactcgggcggagttccttttgtcattcccttcggtggtaccagcgcggtggccgcgcag
ggttacgtcgactgcgcacgcgagatcgagcagcaactccccggagtggaacgcgtcgtg
gttgcactcggatcgggcggaacgatggctggacttgtcgcgcatctgggcgtcgacaga
gttgtcggcgtcgatgtcggggctgttgccgatccagtgtcgaccctcgctgggttattg
gacgagatgcctggtccgaccgtgcgagccgcggatcttcagatcctgcgaaaccaagtt
ggacaaggatattcgacgctcacggaagcatcagccggcgcgatccgatgtttggctcgt
acggagggcatcttcctcgacccgacgtacaccggccgagcctttgcgggattgatccaa
ctcgtgaaggacaaagccatcacggcgggatcaaaaacggtcttcctgcacaccggtggg
ttacctggcctgttcggacatcccgaactgtcgacgctgcggtga

DBGET integrated database retrieval system