KEGG   Rhodococcus erythropolis PR4: RER_56820Help
Entry
RER_56820         CDS       T00881                                 

Definition
(GenBank) putative alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
rer00010  Glycolysis / Gluconeogenesis
rer00071  Fatty acid degradation
rer00350  Tyrosine metabolism
rer00625  Chloroalkane and chloroalkene degradation
rer00626  Naphthalene degradation
rer01100  Metabolic pathways
rer01110  Biosynthesis of secondary metabolites
rer01120  Microbial metabolism in diverse environments
rer01130  Biosynthesis of antibiotics
rer01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RER_56820
  Lipid metabolism
   00071 Fatty acid degradation
    RER_56820
  Amino acid metabolism
   00350 Tyrosine metabolism
    RER_56820
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RER_56820
   00626 Naphthalene degradation
    RER_56820
Enzymes [BR:rer01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RER_56820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: BAH36390
NITE: RER_56820
UniProt: C0ZTX4
Position
6146626..6147666
Genome map
AA seq 346 aa AA seqDB search
MKAAQLMGPGLLEINDVPIPEISPSELLIRVGAAGICHSDLHLLHFPYKMREEPLTIGHE
IAGTIEAVGSGVDGRSVGERGVVYLCWSCGQCRECMSGNENMCLAAGRTAMPPCPGLGPE
GGMAEYVKIPARSFVPIGDLDFLQAAPLADAALTSYHAIRGAREHLQPGATAVVIGVGGL
GHVAVQILRAISAVRIIAVDVGQDQLDLAKRCGADITLESGPDTAQHILDLTSARGAEVI
FDFVGIDATAQMSVQAVAPNGAYRMVGLGGGNPGITAEAAGGPGWPWGASIRKSYGGTRN
DLVDSIALAQAGLVTVEVARFDLADARDALDRLEHGKVTGRAVLVP
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagctcagctcatggggcctggtctcctcgagatcaacgacgtgccgatcccc
gagatcagtccatcggaactgctgattcgggtgggcgcagcgggaatctgccactccgat
ctgcatctcctgcactttccgtacaagatgcgcgaagaaccgctgaccatcggccacgaa
attgccggaacgatcgaagccgtcgggagtggcgtcgacggccgttccgtcggagagcgt
ggcgtcgtctacctgtgctggtcctgtggacagtgccgagaatgcatgagcggcaacgag
aacatgtgcctcgccgctggacgcaccgcgatgccgccctgccccgggctcggtcccgaa
ggcggaatggccgagtacgtcaagatcccggctcgctcattcgtacccatcggagacctc
gacttcctgcaggccgcaccgctcgccgatgcagcactgacgagctaccacgccattcgc
ggcgcacgcgaacatctccagcccggtgccaccgccgtcgtgatcggcgtcggcggactc
ggtcacgttgcagtacagatacttcgcgcaatcagtgccgtgcgcatcatcgccgtcgat
gtcggacaggatcaactcgatctcgccaaacgttgcggcgccgacatcacgctcgaatcg
ggaccggacaccgcgcagcacatcctcgacctcacgtcggccagaggcgcagaagtcatc
ttcgacttcgtcggtatcgacgcaactgcacagatgtccgttcaagcggttgcgccgaac
ggcgcgtatcgcatggtgggtctcggaggcggaaacccgggaatcacagccgaagctgcc
ggcggaccgggctggccgtggggcgcatcgatccggaagtcctatggcggcaccagaaac
gacctcgtcgattccatcgccctggcacaggctggtctggtaacggtagaagtagcccgc
ttcgacctcgctgatgcccgcgacgcactcgaccgtctcgaacacggcaaggtcaccgga
cgcgcagtgctcgtaccctaa

DBGET integrated database retrieval system