KEGG   Rhodococcus erythropolis PR4: RER_56820Help
Entry
RER_56820         CDS       T00881                                 

Definition
putative alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RER_56820
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RER_56820
  Lipid metabolism
   00071 Fatty acid degradation
    RER_56820
  Amino acid metabolism
   00350 Tyrosine metabolism
    RER_56820
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RER_56820
   00626 Naphthalene degradation
    RER_56820
Enzymes [BR:rer01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RER_56820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
6146626..6147666
Genome map
AA seq 346 aa AA seqDB search
MKAAQLMGPGLLEINDVPIPEISPSELLIRVGAAGICHSDLHLLHFPYKMREEPLTIGHE
IAGTIEAVGSGVDGRSVGERGVVYLCWSCGQCRECMSGNENMCLAAGRTAMPPCPGLGPE
GGMAEYVKIPARSFVPIGDLDFLQAAPLADAALTSYHAIRGAREHLQPGATAVVIGVGGL
GHVAVQILRAISAVRIIAVDVGQDQLDLAKRCGADITLESGPDTAQHILDLTSARGAEVI
FDFVGIDATAQMSVQAVAPNGAYRMVGLGGGNPGITAEAAGGPGWPWGASIRKSYGGTRN
DLVDSIALAQAGLVTVEVARFDLADARDALDRLEHGKVTGRAVLVP
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagctcagctcatggggcctggtctcctcgagatcaacgacgtgccgatcccc
gagatcagtccatcggaactgctgattcgggtgggcgcagcgggaatctgccactccgat
ctgcatctcctgcactttccgtacaagatgcgcgaagaaccgctgaccatcggccacgaa
attgccggaacgatcgaagccgtcgggagtggcgtcgacggccgttccgtcggagagcgt
ggcgtcgtctacctgtgctggtcctgtggacagtgccgagaatgcatgagcggcaacgag
aacatgtgcctcgccgctggacgcaccgcgatgccgccctgccccgggctcggtcccgaa
ggcggaatggccgagtacgtcaagatcccggctcgctcattcgtacccatcggagacctc
gacttcctgcaggccgcaccgctcgccgatgcagcactgacgagctaccacgccattcgc
ggcgcacgcgaacatctccagcccggtgccaccgccgtcgtgatcggcgtcggcggactc
ggtcacgttgcagtacagatacttcgcgcaatcagtgccgtgcgcatcatcgccgtcgat
gtcggacaggatcaactcgatctcgccaaacgttgcggcgccgacatcacgctcgaatcg
ggaccggacaccgcgcagcacatcctcgacctcacgtcggccagaggcgcagaagtcatc
ttcgacttcgtcggtatcgacgcaactgcacagatgtccgttcaagcggttgcgccgaac
ggcgcgtatcgcatggtgggtctcggaggcggaaacccgggaatcacagccgaagctgcc
ggcggaccgggctggccgtggggcgcatcgatccggaagtcctatggcggcaccagaaac
gacctcgtcgattccatcgccctggcacaggctggtctggtaacggtagaagtagcccgc
ttcgacctcgctgatgcccgcgacgcactcgaccgtctcgaacacggcaaggtcaccgga
cgcgcagtgctcgtaccctaa

DBGET integrated database retrieval system