KEGG   Rhodococcus erythropolis PR4: RER_57420Help
Entry
RER_57420         CDS       T00881                                 

Definition
putative fatty-acid--CoA ligase (EC:6.2.1.-)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RER_57420
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RER_57420
   00620 Pyruvate metabolism
    RER_57420
   00640 Propanoate metabolism
    RER_57420
  Energy metabolism
   00680 Methane metabolism
    RER_57420
Enzymes [BR:rer01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RER_57420
Lipid biosynthesis proteins [BR:rer01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RER_57420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(6210560..6212197)
Genome map
AA seq 545 aa AA seqDB search
MSWWQDLEAENFEWTVPEQFNIAHACVDVQNPDDLALVVDTGGHWSRYTFGEVATTSRKF
ATVLADLGLVSGDRVGVMVPQGIEVLATHLGAFRSGMVTVPLSVKFGSDAVVHRMRDSGA
KVLVVDKDCYERVADGIGEIPGIEAVIVVGKTDQPSDSTPVRLLDFHSLVDSAAESAELA
ATGPDSHAIIIYTSGTTGNPKGALHGHRILLAHMPGMRTAFDNAPQRGDVFWTPADWAWI
GGLFDVLFPALALGCPVVATPDKFTPARAVEILSRHKVTGAFIPPTALKQMRSIGVDGTA
ARGIRLRALGTGGEALGDALQAWVANTLGVAVNEFYGQTEMNLTIGTSRSKWTPVSGSMG
RAFPGFDVTLLDPLGEPVAVGQVGEICVKAGNPGQFLGYWNQPSKTDEKVYDGWIHTGDL
GRTDEAGNFWYQGRADDVISSAGYRIGPGEIEECLLSHDEVAMAGVIGVPDPLRGEAVHA
FVVLSEGTNSSEELRQELQTHVKSRLAFYQYPRQITFIDSLPLTTTGKILRRELRTLATD
ANGLG
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgtcatggtggcaggatctcgaagcggaaaacttcgaatggactgtgccagagcaattc
aacatcgcgcacgcctgtgtcgatgtgcagaatcccgatgatctagccctcgtcgtagac
accggtggacactggagtcggtacaccttcggtgaagtcgccacgacaagccgtaagttc
gcaaccgtgcttgcggatctcggccttgtctcaggggatcgcgtcggtgtgatggtccca
caggggatcgaggttctcgcgacacatctgggcgccttccgatccggaatggtcaccgtt
ccgctatcggtcaagttcgggtcggatgcggtcgttcatcgaatgcgtgactcgggagcg
aaagtgcttgtggtcgacaaggactgttacgaacgagttgccgacggaataggtgagatc
cccggcatcgaagccgtcatcgttgtcggaaagacggatcagccctccgattcgaccccc
gttcgacttctcgatttccacagcctcgtcgacagtgccgcagaaagcgcggaattggcg
gcgacgggccccgattcacacgccatcatcatctatacctcgggaacgacggggaatccg
aaaggcgccctccacgggcatcgaattctcttggcgcacatgcccggtatgcggacggca
ttcgacaatgcgccgcagcggggagatgtcttctggacgccggcagactgggcctggatc
ggcggtctgttcgacgttctgtttccagcccttgcgttggggtgccccgttgttgcgacg
cccgacaaattcacaccggcgcgtgcggtcgagattctgagccgtcacaaagtaacgggt
gccttcattcctccgactgcactcaagcagatgcggagtatcggcgtcgacggcaccgct
gcgcgtggtattcggctgcgggcattgggaactggcggtgaagccctcggtgacgcattg
caggcgtgggttgcaaacacactcggcgtagctgtcaacgagttctacgggcagacggaa
atgaatctgaccatcggcacttcgcgttcgaagtggacgcccgtgagcggctcgatgggt
cgcgcttttcctggcttcgacgtcaccctcctcgatccgctcggcgagccggtagcggtg
gggcaggtaggcgagatctgtgtgaaggcaggcaaccccggacagttcctcggctattgg
aaccaaccgtcgaagactgatgaaaaggtctacgacgggtggattcataccggtgatctg
ggtcggaccgatgaagcggggaacttctggtaccaggggcgtgccgatgacgtcatttcg
tccgcggggtaccggatcggccccggcgagatcgaagagtgcctgctctcgcacgacgag
gtagctatggccggcgtcatcggtgttccggatccgttgcgcggggaagccgttcacgct
tttgtcgttctgtccgaaggaacgaactcttcggaagagcttcgccaggagttgcagacc
cacgtgaaaagccgccttgctttctaccagtaccccaggcagatcaccttcatcgacagc
ttgccgctcaccaccacgggcaagatcctacgacgggaactccgaacattggccactgac
gcgaacggccttggctaa

DBGET integrated database retrieval system