KEGG   Rhodococcus erythropolis PR4: RER_57570Help
Entry
RER_57570         CDS       T00881                                 

Definition
probable acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rer00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:rer00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:rer00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:rer00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:rer00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
6225149..6226093
Genome map
AA seq 314 aa AA seqDB search
MSKVKVAIIGSGNIGTDLMIKVLRNSDYLEMGAMVGIDPASDGLARAARLNVPITAEGVE
GLIGLPNFDEIEIVFDATSAKAHVANNARLAPLGKRMIDLTPAAIGPYVVPAVNADEHLD
APNVNMVTCGGQATIPMVAAVSRVVPVAYAEIVASIASKSAGPGTRANIDEFTETTSEAI
VAVGGARRGKAIIILNPAEPPLIMRDTVFCLVDAPDPAVHEEIRQSIEKMVGDVSAYVPG
YRLKQEVQITEIPADQPVETLLVDGNRPTHQVSVFLEVEGAAHYLPAYAGNLDIMTSAGM
QIAERIAQQKEATK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggtcaaggtcgcgatcatcggatcgggcaacatcggcacggatctgatgatc
aaggtgctgcgcaactccgactacctggagatgggcgcgatggtcggcatcgacccggcg
tcggacggcctcgcccgcgcagcgcgtctgaacgtgccgatcacggctgaaggtgtcgag
ggtttgatcggtctgccgaacttcgacgagatcgagatcgtcttcgacgccacctcggca
aaggctcacgtcgccaacaacgcgcggctggctcccctcggcaagcgcatgatcgacctg
acgcctgccgccatcggcccgtacgtcgtgccggccgtcaacgccgacgagcacctggac
gcacccaacgtcaacatggtgacgtgtggtggccaggccacgatcccgatggttgcggct
gtttctcgggtcgtcccggtggcgtatgcggagatcgtcgcgtccatcgcctccaagtcc
gccggtcccggaacgcgcgccaacatcgacgagttcaccgagaccacatccgaggcgatc
gtggcagtcggcggcgcccgccgcggcaaggccatcatcatcctcaaccccgccgagccg
ccgctcatcatgcgcgacacggtgttctgcctcgtcgacgccccggacccggctgttcac
gaggagatccgtcagtccatcgagaagatggtcggcgacgtctccgcctatgttccgggc
taccgcctcaagcaggaagtccagatcaccgagatcccggccgaccagcccgtcgagacg
ttgctcgtcgacggcaatcgccccacccatcaggtgtcggtgttcctcgaggtcgagggt
gctgcacactacctgcctgcgtacgccggcaatctcgacatcatgacgtccgccggaatg
cagatcgcggagcgcatcgcccagcagaaggaagcaaccaagtga

DBGET integrated database retrieval system