KEGG   Rhodococcus erythropolis PR4: RER_57570Help
Entry
RER_57570         CDS       T00881                                 

Definition
probable acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RER_57570
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RER_57570
   00650 Butanoate metabolism
    RER_57570
  Amino acid metabolism
   00360 Phenylalanine metabolism
    RER_57570
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RER_57570
   00622 Xylene degradation
    RER_57570
   00621 Dioxin degradation
    RER_57570
Enzymes [BR:rer01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     RER_57570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
6225149..6226093
Genome map
AA seq 314 aa AA seqDB search
MSKVKVAIIGSGNIGTDLMIKVLRNSDYLEMGAMVGIDPASDGLARAARLNVPITAEGVE
GLIGLPNFDEIEIVFDATSAKAHVANNARLAPLGKRMIDLTPAAIGPYVVPAVNADEHLD
APNVNMVTCGGQATIPMVAAVSRVVPVAYAEIVASIASKSAGPGTRANIDEFTETTSEAI
VAVGGARRGKAIIILNPAEPPLIMRDTVFCLVDAPDPAVHEEIRQSIEKMVGDVSAYVPG
YRLKQEVQITEIPADQPVETLLVDGNRPTHQVSVFLEVEGAAHYLPAYAGNLDIMTSAGM
QIAERIAQQKEATK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggtcaaggtcgcgatcatcggatcgggcaacatcggcacggatctgatgatc
aaggtgctgcgcaactccgactacctggagatgggcgcgatggtcggcatcgacccggcg
tcggacggcctcgcccgcgcagcgcgtctgaacgtgccgatcacggctgaaggtgtcgag
ggtttgatcggtctgccgaacttcgacgagatcgagatcgtcttcgacgccacctcggca
aaggctcacgtcgccaacaacgcgcggctggctcccctcggcaagcgcatgatcgacctg
acgcctgccgccatcggcccgtacgtcgtgccggccgtcaacgccgacgagcacctggac
gcacccaacgtcaacatggtgacgtgtggtggccaggccacgatcccgatggttgcggct
gtttctcgggtcgtcccggtggcgtatgcggagatcgtcgcgtccatcgcctccaagtcc
gccggtcccggaacgcgcgccaacatcgacgagttcaccgagaccacatccgaggcgatc
gtggcagtcggcggcgcccgccgcggcaaggccatcatcatcctcaaccccgccgagccg
ccgctcatcatgcgcgacacggtgttctgcctcgtcgacgccccggacccggctgttcac
gaggagatccgtcagtccatcgagaagatggtcggcgacgtctccgcctatgttccgggc
taccgcctcaagcaggaagtccagatcaccgagatcccggccgaccagcccgtcgagacg
ttgctcgtcgacggcaatcgccccacccatcaggtgtcggtgttcctcgaggtcgagggt
gctgcacactacctgcctgcgtacgccggcaatctcgacatcatgacgtccgccggaatg
cagatcgcggagcgcatcgcccagcagaaggaagcaaccaagtga

DBGET integrated database retrieval system