KEGG   Rhodococcus erythropolis PR4: pREC1_0070Help
Entry
pREC1_0070        CDS       T00881                                 

Gene name
echA
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    pREC1_0070 (echA)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    pREC1_0070 (echA)
   00650 Butanoate metabolism
    pREC1_0070 (echA)
  Lipid metabolism
   00071 Fatty acid degradation
    pREC1_0070 (echA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    pREC1_0070 (echA)
   00310 Lysine degradation
    pREC1_0070 (echA)
   00360 Phenylalanine metabolism
    pREC1_0070 (echA)
   00380 Tryptophan metabolism
    pREC1_0070 (echA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    pREC1_0070 (echA)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    pREC1_0070 (echA)
   00281 Geraniol degradation
    pREC1_0070 (echA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    pREC1_0070 (echA)
   00627 Aminobenzoate degradation
    pREC1_0070 (echA)
   00930 Caprolactam degradation
    pREC1_0070 (echA)
Enzymes [BR:rer01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     pREC1_0070 (echA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
pREC1:complement(74760..75548)
Genome map
AA seq 262 aa AA seqDB search
MNPDNAPLRTARDSHLLILEINRPKARNSLNEAVLTALNTELVAARHDDEIRAIVLTGAG
GIFCAGADITNFDAIRDQSLLGDRAALGGTIWADLGRFPKPVLAAVEGLALGGGCELALA
CDIVIAGESAKFGVPEVKLGVIPGGGGTQRLIQAVGKSKAMALLLTGDFLSAQRACAAGI
VAETVPDGTALEAAVAMAQRIAANSPLAVALAKDAALQALETSLAQGLEHEKRNFHVAIH
SADSREGQAAFLAKRAPEFTGK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccgacaacgccccgctacgcacggcccgcgacagccacctcctgatcctggag
atcaaccggcccaaggctcgcaacagtctgaacgaggcggtgctcaccgccttgaacacc
gagctcgtcgcggctcggcacgacgacgagatccgtgccatcgtgctcaccggcgccggc
gggatcttctgcgccggagccgacatcaccaatttcgacgccattcgcgaccagtcgctg
ctcggcgatcgagccgcgctgggcggcaccatctgggccgacctgggccgattcccgaag
ccggtcctcgctgcggtcgagggcctcgcactcggcggcggctgcgagttggcgcttgcc
tgcgacatcgtcatcgccggcgaatccgccaagttcggtgtcccggaggtgaagctcggc
gtgatcccgggcggcggcggaacccagcgcctgattcaggccgtcggcaagtccaaggcg
atggccctactgctcaccggcgacttcctgtccgcacagcgggcgtgcgcggccggcatc
gtcgccgagaccgtcccggacggcaccgccctcgaagcggcggtcgccatggcgcagcgg
atcgccgccaactcaccgctcgcggtggcgctggccaaggatgccgccctccaggccctg
gaaacctctctggcgcaaggactcgagcacgagaagcgcaactttcacgttgccatccat
tccgccgacagccgcgagggccaggccgcgttcctcgccaagcgcgcccccgaattcacc
ggaaagtag

DBGET integrated database retrieval system