KEGG   Rhizobium etli CFN 42: RHE_CH00021Help
Entry
RHE_CH00021       CDS       T00317                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain protein
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00260  Glycine, serine and threonine metabolism
ret00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ret01100  Metabolic pathways
ret01110  Biosynthesis of secondary metabolites
ret01130  Biosynthesis of antibiotics
ret01230  Biosynthesis of amino acids
Module
ret_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHE_CH00021 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RHE_CH00021 (trpB)
Enzymes [BR:ret01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RHE_CH00021 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABC88854
RhizoBase: RHE_CH00021
UniProt: Q2KE82
Position
17527..18747
Genome map
AA seq 406 aa AA seqDB search
MNETPKPNSFRSGPDEDGRFGIYGGRFVAETLMPLILDLQDEWNKAKSDPAFQAELKHLG
AHYIGRPSPLYFAERLTAELGGAKIYFKREELNHTGSHKINNCIGQILLAKRMGKTRIIA
ETGAGQHGVASATVAARFGLPCVVYMGATDVERQAPNVFRMKLLGAEVKPVTAGSGTLKD
AMNEALRDWVTNVEDTYYLIGTAAGPHPYPEMVRDFQSVIGAEAKEQMLAAEGRLPDLVV
AAVGGGSNAIGIFHPFLDDSSVKIVGVEAGGKGLQGDEHCASITAGSPGVLHGNRTYLLQ
DGDGQIKEGHSISAGLDYPGIGPEHSWLSDIGRVDYVPIMDHEALEAFQTLTRLEGIIPA
LEAAHAIAEVIKRAPKMGKDEIILMNLSGRGDKDIFTVGKILGMGL
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgaaacgcctaaaccgaattccttccgttccggacctgacgaagatggtcgtttc
ggcatctacggcggtcgtttcgttgccgaaacgttgatgccgctgattctcgatctgcag
gacgaatggaacaaggcgaagagcgatccggccttccaggcggaattgaagcatctcggc
gcgcactatatcggccggccgagcccgctttattttgctgaacggctgacggccgaactc
ggcggcgcgaagatctatttcaagcgcgaggagctgaaccacaccggctcgcacaagatc
aacaattgcatcggccagatcctgctcgccaagcgcatgggcaagacgcggatcatcgcc
gagaccggcgccggccagcatggcgtcgcctccgcaaccgtcgccgcccgcttcggcctt
ccctgcgtggtctacatgggcgcgaccgatgtcgagcggcaggcgccgaacgttttccgc
atgaagctgctcggcgccgaagtcaaaccggtgacggcaggtagcggcacgctgaaggac
gccatgaacgaggcgctccgcgactgggtcaccaatgtcgaggatacctattacttgatc
ggcacggcggccggcccgcatccctatccggagatggtccgcgatttccagtcggtgatc
ggcgcggaagcgaaagagcagatgctggccgccgaaggccgcctgccggatctcgtcgtc
gctgccgtcggcggcggatcgaatgcgatcggcatcttccaccccttcctcgacgattcc
tcggtgaagatcgtcggcgtcgaagccggcggcaagggcctgcagggcgacgaacattgc
gcctcgatcaccgccgggtcccctggcgttctgcacggcaaccgcacctacctgctgcag
gatggcgacggccagatcaaggaaggccattccatttcggccggtctcgattatcccggc
atcggtcccgaacattcctggctgagcgatatcggccgcgtcgactacgtgccgatcatg
gaccacgaggcgctcgaggctttccagaccctgacccgcctcgaaggcatcattccggcg
cttgaggccgcgcatgcgatcgccgaggtcatcaagcgcgcgccgaagatgggcaaggac
gagatcatcctgatgaacctctccggccgcggcgacaaggatatcttcaccgtcggcaag
attctgggaatgggactgtaa

DBGET integrated database retrieval system