KEGG   Rhizobium etli CFN 42: RHE_CH00021Help
Entry
RHE_CH00021       CDS       T00317                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ret  Rhizobium etli CFN 42
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RHE_CH00021 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHE_CH00021 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RHE_CH00021 (trpB)
Enzymes [BR:ret01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RHE_CH00021 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
17527..18747
Genome map
AA seq 406 aa AA seqDB search
MNETPKPNSFRSGPDEDGRFGIYGGRFVAETLMPLILDLQDEWNKAKSDPAFQAELKHLG
AHYIGRPSPLYFAERLTAELGGAKIYFKREELNHTGSHKINNCIGQILLAKRMGKTRIIA
ETGAGQHGVASATVAARFGLPCVVYMGATDVERQAPNVFRMKLLGAEVKPVTAGSGTLKD
AMNEALRDWVTNVEDTYYLIGTAAGPHPYPEMVRDFQSVIGAEAKEQMLAAEGRLPDLVV
AAVGGGSNAIGIFHPFLDDSSVKIVGVEAGGKGLQGDEHCASITAGSPGVLHGNRTYLLQ
DGDGQIKEGHSISAGLDYPGIGPEHSWLSDIGRVDYVPIMDHEALEAFQTLTRLEGIIPA
LEAAHAIAEVIKRAPKMGKDEIILMNLSGRGDKDIFTVGKILGMGL
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgaaacgcctaaaccgaattccttccgttccggacctgacgaagatggtcgtttc
ggcatctacggcggtcgtttcgttgccgaaacgttgatgccgctgattctcgatctgcag
gacgaatggaacaaggcgaagagcgatccggccttccaggcggaattgaagcatctcggc
gcgcactatatcggccggccgagcccgctttattttgctgaacggctgacggccgaactc
ggcggcgcgaagatctatttcaagcgcgaggagctgaaccacaccggctcgcacaagatc
aacaattgcatcggccagatcctgctcgccaagcgcatgggcaagacgcggatcatcgcc
gagaccggcgccggccagcatggcgtcgcctccgcaaccgtcgccgcccgcttcggcctt
ccctgcgtggtctacatgggcgcgaccgatgtcgagcggcaggcgccgaacgttttccgc
atgaagctgctcggcgccgaagtcaaaccggtgacggcaggtagcggcacgctgaaggac
gccatgaacgaggcgctccgcgactgggtcaccaatgtcgaggatacctattacttgatc
ggcacggcggccggcccgcatccctatccggagatggtccgcgatttccagtcggtgatc
ggcgcggaagcgaaagagcagatgctggccgccgaaggccgcctgccggatctcgtcgtc
gctgccgtcggcggcggatcgaatgcgatcggcatcttccaccccttcctcgacgattcc
tcggtgaagatcgtcggcgtcgaagccggcggcaagggcctgcagggcgacgaacattgc
gcctcgatcaccgccgggtcccctggcgttctgcacggcaaccgcacctacctgctgcag
gatggcgacggccagatcaaggaaggccattccatttcggccggtctcgattatcccggc
atcggtcccgaacattcctggctgagcgatatcggccgcgtcgactacgtgccgatcatg
gaccacgaggcgctcgaggctttccagaccctgacccgcctcgaaggcatcattccggcg
cttgaggccgcgcatgcgatcgccgaggtcatcaagcgcgcgccgaagatgggcaaggac
gagatcatcctgatgaacctctccggccgcggcgacaaggatatcttcaccgtcggcaag
attctgggaatgggactgtaa

DBGET integrated database retrieval system