KEGG   Rhizobium etli CFN 42: RHE_CH00022Help
Entry
RHE_CH00022       CDS       T00317                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain protein
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00260  Glycine, serine and threonine metabolism
ret00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ret01100  Metabolic pathways
ret01110  Biosynthesis of secondary metabolites
ret01130  Biosynthesis of antibiotics
ret01230  Biosynthesis of amino acids
Module
ret_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHE_CH00022 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RHE_CH00022 (trpA)
Enzymes [BR:ret01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RHE_CH00022 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: ABC88855
RhizoBase: RHE_CH00022
UniProt: Q2KE81
Position
18751..19590
Genome map
AA seq 279 aa AA seqDB search
MTARMDKRFAELKAEGRPALVTYFMGGDPDYDTSLGIMKALPEAGSDIIELGMPFSDPMA
DGPAIQLAGQRALKGGQTLKKTLQLAADFRKTNDLTPIVMMGYYNPIYIYGVEKFLDDAL
AAGIDGLIVVDLPPEMDDELCIPAIRKGINFIRLATPTTDEKRLPTVLKNTSGFVYYVSM
NGITGSALPDPSLVSGAVQRIKQHTELPVCVGFGVKTAEHAKVIGGSADGVVVGTAIVNQ
VATSLTKDGKATPDTVQAVATLVRGLSSGARSARLVAAE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacgcatggacaaacgctttgccgagctgaaggccgagggccgtccggcgctt
gtgacctatttcatgggcggcgatcctgactacgatacctctctcggcatcatgaaggcg
ctgcctgaagcaggttccgacatcatcgagctcggcatgcccttttccgatccgatggcc
gacggcccggcgatccagctggccggtcagcgggcgttgaaaggcggccagacgctgaag
aagacgctgcagctggcggctgatttccgcaagaccaacgatttaacgccgatcgtgatg
atgggctattacaatccgatctatatctacggcgtcgaaaagttcctcgatgatgcactc
gccgccggcatcgacggcctgatcgtcgtcgacctgccgccggagatggacgacgaactc
tgcattccggcgatccgcaagggcatcaacttcatccgcctggcgacgccgaccaccgac
gaaaagcgcctgcccaccgtgttgaaaaacacctccggcttcgtctactacgtgtcgatg
aacggcattaccggctcggcactgcccgatccgtcgctggtttcgggcgccgtccagcgt
atcaagcagcatacggagctgcccgtttgcgtcggtttcggcgtcaagacggcggagcac
gcgaaggtcattggcggctctgccgacggcgtcgtcgtcggcaccgccatcgtcaatcag
gtcgcaacaagcttgacgaaagacggaaaggcgacgcccgacacggttcaggcggtcgca
acgctggtgcgcggcctctcatcgggagcacgttcggcgcgccttgttgctgccgaatag

DBGET integrated database retrieval system