KEGG   Rhizobium etli CFN 42: RHE_CH00022Help
Entry
RHE_CH00022       CDS       T00317                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ret  Rhizobium etli CFN 42
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RHE_CH00022 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHE_CH00022 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RHE_CH00022 (trpA)
Enzymes [BR:ret01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RHE_CH00022 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
18751..19590
Genome map
AA seq 279 aa AA seqDB search
MTARMDKRFAELKAEGRPALVTYFMGGDPDYDTSLGIMKALPEAGSDIIELGMPFSDPMA
DGPAIQLAGQRALKGGQTLKKTLQLAADFRKTNDLTPIVMMGYYNPIYIYGVEKFLDDAL
AAGIDGLIVVDLPPEMDDELCIPAIRKGINFIRLATPTTDEKRLPTVLKNTSGFVYYVSM
NGITGSALPDPSLVSGAVQRIKQHTELPVCVGFGVKTAEHAKVIGGSADGVVVGTAIVNQ
VATSLTKDGKATPDTVQAVATLVRGLSSGARSARLVAAE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacgcatggacaaacgctttgccgagctgaaggccgagggccgtccggcgctt
gtgacctatttcatgggcggcgatcctgactacgatacctctctcggcatcatgaaggcg
ctgcctgaagcaggttccgacatcatcgagctcggcatgcccttttccgatccgatggcc
gacggcccggcgatccagctggccggtcagcgggcgttgaaaggcggccagacgctgaag
aagacgctgcagctggcggctgatttccgcaagaccaacgatttaacgccgatcgtgatg
atgggctattacaatccgatctatatctacggcgtcgaaaagttcctcgatgatgcactc
gccgccggcatcgacggcctgatcgtcgtcgacctgccgccggagatggacgacgaactc
tgcattccggcgatccgcaagggcatcaacttcatccgcctggcgacgccgaccaccgac
gaaaagcgcctgcccaccgtgttgaaaaacacctccggcttcgtctactacgtgtcgatg
aacggcattaccggctcggcactgcccgatccgtcgctggtttcgggcgccgtccagcgt
atcaagcagcatacggagctgcccgtttgcgtcggtttcggcgtcaagacggcggagcac
gcgaaggtcattggcggctctgccgacggcgtcgtcgtcggcaccgccatcgtcaatcag
gtcgcaacaagcttgacgaaagacggaaaggcgacgcccgacacggttcaggcggtcgca
acgctggtgcgcggcctctcatcgggagcacgttcggcgcgccttgttgctgccgaatag

DBGET integrated database retrieval system