KEGG   Rhizobium etli CFN 42: RHE_CH00052Help
Entry
RHE_CH00052       CDS       T00317                                 

Gene name
glcB
Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ret  Rhizobium etli CFN 42
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RHE_CH00052 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RHE_CH00052 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    RHE_CH00052 (glcB)
Enzymes [BR:ret01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     RHE_CH00052 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
52942..55113
Genome map
AA seq 723 aa AA seqDB search
MSRIDKNGLAIETILHDFLTQEVLPGLAIDADRFFADFSAIVHDLAPRNRALLVKRDELQ
TKIDDWYRQHGAPSDMDDYQSFLRSIGYLLPEGSDFQVSTANVDPEIASIAGPQLVVPVM
NARYALNAANARWGSLYDALYGTDAIPENDGAEKGKGYNPKRGEKVIAWVRDFLDAAAPL
QDSRWKDVGSFFVKDGMLVVRSVDGEQTMLGDGGHFAGYRGDAAAPAHILLKNNGIHIDI
VIDPTTAIGKADPAHISDVWLESAITTIMDCEDSIAAVDAEDKVVVYRNWLGLMKGDLQE
EVAKGGTTFLRKLNPDLDYTSPDGASFELHRRSLMLVRNVGHLMTNPAILDKDGNEVPEG
IMDAVITGLIALYDIGPTGRKKNSRTGSMYVVKPKMHGPEEVAFAVEIFSRVEDALGMAR
NTIKMGIMDEERRTTINLKECIRAARERVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMR
QAAWISAYENWNVDIGLECGLSGHAQIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPS
PTAATLHATHYHRVNVAKVQQGLKDRARARLSDILSVPVAVRPNWTPEEIQRELDNNAQG
ILGYVVRWIDQGVGCSKVPDINNIGLMEDRATLRISAQHMANWLHHKVVTEAQIVETMKR
MAAIVDRQNESDPAYRPMAGNFDDSIAFQAALDLVLKGREQPNGYTEPVLHRRRLELKAK
QSA
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcattgataagaacggtcttgccatcgaaaccatccttcatgatttcctgact
caggaggttctgccgggtctggcgatcgatgcggacaggttctttgccgatttttcggcg
atcgtccacgatctcgccccgcgcaatcgcgcgctgctggtcaaacgcgacgagctgcag
acgaagatcgatgactggtatcgccagcatggcgccccgtcggatatggacgactaccag
tcctttctccgcagcatcggctacctcctgccggaaggatcggacttccaggtttcaacc
gcaaacgtcgatcccgaaatcgcctcgatcgccggtccacagcttgtcgttcccgtgatg
aatgcgcgttacgccctgaacgccgccaatgctcgctggggctcgctctatgacgcgctc
tacggcaccgacgccattcccgagaacgacggcgccgagaagggcaagggctacaacccg
aagcgcggcgaaaaggtcatcgcctgggtgcgagatttcctcgatgcggcggcgccgctg
caggacagcagatggaaggatgtcggcagcttcttcgtcaaggacggaatgctcgtcgtc
agatcggtcgacggcgagcagacaatgctcggggatggggggcattttgccggctatcgc
ggtgatgccgcggcgccggcgcatattctcctgaagaacaacggcattcatatcgatatc
gtcatcgacccgacaacggcgatcggcaaggccgatccggcccatatctccgatgtttgg
ttggaatcggcaatcaccacgatcatggactgcgaggattcgattgccgccgtcgatgcc
gaggacaaggtcgtcgtctatcgcaactggctcggcctgatgaagggcgatctgcaggaa
gaggtggcaaagggcggaacgaccttcctccgcaagctcaacccggatctggactatacc
agcccggatggcgcttcgttcgagttgcatcgccgttcattgatgctggtgcgcaatgtc
ggccacctcatgaccaatcccgcgattctcgacaaggacggcaatgaagtgcctgagggc
atcatggatgccgtcataaccggcctgatcgcgctttacgatatcggtcccactggtcgg
aagaagaattcccgcaccggctccatgtatgtggtcaagccgaagatgcatgggcctgag
gaggtcgccttcgccgtcgagattttctcccgggtcgaagacgcgctcggcatggcgcgc
aacaccatcaagatgggcatcatggacgaggagcggcgcacgacgatcaatctcaaggag
tgcatccgcgccgcccgcgagcgtgtcgtcttcatcaataccggcttcctcgaccgcacc
ggcgacgagatccacacttcgatggaagccggtccaatgattcgcaagggcgatatgcgc
caggcagcgtggatatcggcctatgagaactggaacgttgatatcggtctggaatgcggc
ctttccggccatgcccagatcggcaagggcatgtgggcgatgccggatctgatggcggca
atgctggaacagaagatcgcccaccccaaggccggcgccaataccgcttgggtgccttcg
ccgacggctgcaaccctgcatgccacccattatcaccgcgtcaatgtcgccaaggtccag
caggggctgaaggaccgggctcgcgccaggctttccgacattctctccgtgccggttgcg
gtgcggccgaactggacgccggaggaaatccagcgagagctcgacaacaatgcccagggt
atcctcggctatgtcgtgcgctggatcgatcagggcgtcggctgctcgaaagtgcccgac
atcaacaatatcggcctgatggaggatcgcgcgaccttgcgcatttcggcccagcacatg
gcgaattggctgcatcacaaggtcgtcaccgaagctcagatcgtcgaaacaatgaaacgc
atggctgccatcgtcgaccgccagaacgaatccgatccagcctaccggccgatggccggc
aatttcgatgattcgatcgctttccaggccgccctcgatctcgtcctgaagggcagggag
caaccgaacggctatactgaaccggtgcttcaccgccgccgcctcgagctcaaggcgaaa
caatcggcgtga

DBGET integrated database retrieval system