KEGG   Rhizobium etli CFN 42: RHE_CH00133Help
Entry
RHE_CH00133       CDS       T00317                                 

Gene name
cycM
Definition
(GenBank) cytochrome-c protein
  KO
K08738  cytochrome c
Organism
ret  Rhizobium etli CFN 42
Pathway
ret01100  Metabolic pathways
ret01120  Microbial metabolism in diverse environments
ret02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ret00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RHE_CH00133 (cycM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ABC88958
RhizoBase: RHE_CH00133
UniProt: Q2KDX8
Position
143199..143762
Genome map
AA seq 187 aa AA seqDB search
MNSYVNTAVGALLGTIFVLMSVSIASEGIFHSEAPEKEGFAIVAEEAPAAGGEAATAAAV
PIAQLLASADAKAGEAVFKKCQACHDGTKGGPNKVGPNLFGVVDRPIASHEGFAYSSAMK
DFSKGSSEKWTFENLNKFLLAPKKDVPGTAMGFAGLPKDQDRANVILYLHTLADSPVPLP
DPKTATQ
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaattcatacgtcaatacggccgtgggggcgctgctcggaacgattttcgttctgatg
tcggtctccatcgcgtccgaggggatcttccattccgaagcgccggagaaggaaggtttc
gcgatcgtcgccgaagaggcgcctgccgccggtggcgaagctgcgacggccgctgccgtc
ccgattgcgcagttgctcgcttctgcagatgccaaggccggtgaagcggtcttcaagaag
tgtcaggcctgtcatgacggcaccaaaggcggaccgaacaaggtcggtccgaacctcttt
ggtgtcgtagatcgcccgatcgcctcgcatgaaggtttcgcctattcctccgcgatgaag
gatttctcaaagggcagcagcgagaagtggaccttcgaaaacctcaacaagttcctgctg
gcgccgaagaaggacgttcccggcaccgcgatgggctttgccggtctgccgaaggatcag
gaccgcgccaacgtcatcctctacctgcacacgctcgccgattcgccggtgccgctgccg
gatccgaagacggccacgcagtga

DBGET integrated database retrieval system