KEGG   Rhizobium etli CFN 42: RHE_CH00133Help
Entry
RHE_CH00133       CDS       T00317                                 

Gene name
cycM
Definition
cytochrome-c protein
Orthology
K08738  
cytochrome c
Organism
ret  Rhizobium etli CFN 42
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RHE_CH00133 (cycM)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RHE_CH00133 (cycM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
143199..143762
Genome map
AA seq 187 aa AA seqDB search
MNSYVNTAVGALLGTIFVLMSVSIASEGIFHSEAPEKEGFAIVAEEAPAAGGEAATAAAV
PIAQLLASADAKAGEAVFKKCQACHDGTKGGPNKVGPNLFGVVDRPIASHEGFAYSSAMK
DFSKGSSEKWTFENLNKFLLAPKKDVPGTAMGFAGLPKDQDRANVILYLHTLADSPVPLP
DPKTATQ
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaattcatacgtcaatacggccgtgggggcgctgctcggaacgattttcgttctgatg
tcggtctccatcgcgtccgaggggatcttccattccgaagcgccggagaaggaaggtttc
gcgatcgtcgccgaagaggcgcctgccgccggtggcgaagctgcgacggccgctgccgtc
ccgattgcgcagttgctcgcttctgcagatgccaaggccggtgaagcggtcttcaagaag
tgtcaggcctgtcatgacggcaccaaaggcggaccgaacaaggtcggtccgaacctcttt
ggtgtcgtagatcgcccgatcgcctcgcatgaaggtttcgcctattcctccgcgatgaag
gatttctcaaagggcagcagcgagaagtggaccttcgaaaacctcaacaagttcctgctg
gcgccgaagaaggacgttcccggcaccgcgatgggctttgccggtctgccgaaggatcag
gaccgcgccaacgtcatcctctacctgcacacgctcgccgattcgccggtgccgctgccg
gatccgaagacggccacgcagtga

DBGET integrated database retrieval system