KEGG   Rhizobium etli CFN 42: RHE_CH00135Help
Entry
RHE_CH00135       CDS       T00317                                 

Definition
(GenBank) probable sugar kinase protein
Organism
ret  Rhizobium etli CFN 42
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
145313..146305
Genome map
AA seq 330 aa AA seqDB search
MTRFDVLTVGNAIVDIISRCNDQFLIDNQITKAAMNLIDAERAELLYSRMGPALEASGGS
AGNTAAGVANLGGKAAYFGNVAADQLGDIFTHDIRAQGVHYQTKPKGAFPPTARSMIFVT
EDGERSMNTYLGACVELGPEDVEADVVADAKVTYFEGYLWDPPRAKEAILDCARIAHQHG
REMSMTLSDSFCVDRYRGEFLDLMRSGKVDIVFANRQEALSLYQTDDFEEALNRIAADCK
IAAVTMSENGAVILKGRERYYVNAIRIREVVDTTGAGDLFASGFLYGYTQGRSLEDCGKL
GCLAAGIVIQQIGPRPMTSLSEAAKQAGLI
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgacaagattcgatgttctgacggtcggcaacgcaatcgtggatatcatctcccgttgc
aacgaccagttcctaattgacaaccagatcacgaaggcggcgatgaacctcatcgacgcc
gaacgcgccgaactcttgtattcgcgcatgggaccggcactggaagcctccggcggcagc
gccggcaacacggcggcgggcgttgctaatctcggcggcaaggccgcctatttcggcaat
gtcgccgcagatcagctcggagacatctttacccacgacatccgcgctcagggcgtccac
tatcagacgaagccgaagggcgccttcccgccgacggcgcgctcgatgatcttcgtcacc
gaggatggcgagcgttcgatgaatacctatctcggcgcatgcgtcgaactcggtcctgag
gatgtcgaagccgatgtcgttgccgatgccaaggtcacttatttcgaaggttatctgtgg
gatccgccgcgcgccaaggaggcgattctcgattgcgcccgcatcgcccatcaacacggc
cgggaaatgtcgatgacgctgtccgacagtttctgcgtcgaccggtaccgcggagagttc
ctcgatctgatgcgctccggcaaggtcgatatcgtctttgccaatcgccaggaggcgctg
tcgctttaccagaccgacgatttcgaagaggcgctgaacaggatcgccgcggactgcaag
atcgccgccgtgacgatgagcgagaacggcgccgtcatcctgaagggccgggagcgttat
tacgtcaatgcgatcaggatccgggaagttgtggatacaacgggtgccggcgacctgttt
gcctccggcttcctctatggctacacgcagggacggtccctggaggattgcgggaagctc
ggttgtctcgccgccggtattgtcattcagcagatcggcccacgcccgatgacttcgctt
tccgaggccgccaaacaagcggggcttatttga

DBGET integrated database retrieval system