KEGG   Rhizobium etli CFN 42: RHE_CH00172Help
Entry
RHE_CH00172       CDS       T00317                                 

Gene name
glk
Definition
(GenBank) glucokinase (glucose kinase) protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00010  Glycolysis / Gluconeogenesis
ret00052  Galactose metabolism
ret00500  Starch and sucrose metabolism
ret00520  Amino sugar and nucleotide sugar metabolism
ret00521  Streptomycin biosynthesis
ret01100  Metabolic pathways
ret01110  Biosynthesis of secondary metabolites
ret01120  Microbial metabolism in diverse environments
ret01130  Biosynthesis of antibiotics
ret01200  Carbon metabolism
Module
ret_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHE_CH00172 (glk)
   00052 Galactose metabolism
    RHE_CH00172 (glk)
   00500 Starch and sucrose metabolism
    RHE_CH00172 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    RHE_CH00172 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RHE_CH00172 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    RHE_CH00172 (glk)
Enzymes [BR:ret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RHE_CH00172 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: ABC88997
RhizoBase: RHE_CH00172
UniProt: Q2KDT9
Position
complement(186614..187639)
Genome map
AA seq 341 aa AA seqDB search
MPKSNHSTAPLPFPILIGDIGGTNARFSILTDAYAEPKQFPNVRTADFATIDEAIQKGVL
DKTAVQPRSAILAVAGPINDDEIPLTNCAWVVRPKTMIEGLGIEDVLVVNDFEAQALAIA
ALSDENRERIGSATGDMVASRVVLGPGTGLGVGGLVHAQHTWIPVPGEGGHIDLGPRSKR
DYEIFPHIETIEGRVSAEQILCGRGLVNLYNAICVVDGIQPTMKDPADITSHALDGSDKV
AVETVSLFATYLGRVAGDMAMVFMARGGVYLSGGISQKIIPALKKPEFRQAFEDKAPHSA
LLRTIPTYVVTHPLAALAGLSSYARMPANFGVSTEGRRWRR
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaatccaaccacagcaccgctccgcttcccttcccgatcctgatcggcgatatc
ggcggcaccaatgcccgcttctccatcctgaccgatgcctatgccgaaccgaaacagttt
ccgaacgtgcgcacggcggatttcgccacgatcgacgaggcgatccaaaagggcgtgctc
gacaagacggcggtgcagccgcgctcggcgatcctcgccgtcgccggcccgatcaacgac
gatgagatccccctgaccaattgcgcctgggtggtgcggcccaagacgatgatcgagggc
ctcggtatcgaggatgtgctcgtcgtcaacgatttcgaggcgcaggcactagcgattgcc
gccctgtcggatgaaaaccgcgaacgcatcggcagcgccaccggcgacatggttgcctcg
cgcgtcgtgctcggacccggcaccggcctcggcgtcggcgggcttgtgcatgcccagcat
acttggatcccggttcccggcgaaggcggccatatcgatctcgggccgcgcagcaagcgc
gattatgagatatttccgcatatcgagacgatcgaaggtcgtgtttcggccgagcagatc
ctctgcggacgcggcctcgtcaatctctataacgccatctgcgtggtcgacggtatccag
ccgacgatgaaggatccggccgacatcacatcgcacgcgcttgatggcagcgacaaggtc
gccgtcgagaccgtttcgctgtttgccacctatctcggccgcgtggcgggcgacatggcg
atggtgttcatggcgcgcggcggcgtctatctctccggcggcatctcgcagaagatcatc
cccgcgctgaagaagccggaattccggcaggctttcgaggacaaggcgccgcatagcgcg
ctgcttcgcaccatcccgacctatgtggtgacgcatccgctggcggcgctcgcagggctt
tcctcctatgcgcgcatgccggccaatttcggcgtatcgacggaaggccgccgctggcgg
cgctga

DBGET integrated database retrieval system