KEGG   Rhizobium etli CFN 42: RHE_CH00172Help
Entry
RHE_CH00172       CDS       T00317                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ret  Rhizobium etli CFN 42
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RHE_CH00172 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHE_CH00172 (glk)
   00052 Galactose metabolism
    RHE_CH00172 (glk)
   00500 Starch and sucrose metabolism
    RHE_CH00172 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    RHE_CH00172 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RHE_CH00172 (glk)
   00524 Butirosin and neomycin biosynthesis
    RHE_CH00172 (glk)
Enzymes [BR:ret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RHE_CH00172 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(186614..187639)
Genome map
AA seq 341 aa AA seqDB search
MPKSNHSTAPLPFPILIGDIGGTNARFSILTDAYAEPKQFPNVRTADFATIDEAIQKGVL
DKTAVQPRSAILAVAGPINDDEIPLTNCAWVVRPKTMIEGLGIEDVLVVNDFEAQALAIA
ALSDENRERIGSATGDMVASRVVLGPGTGLGVGGLVHAQHTWIPVPGEGGHIDLGPRSKR
DYEIFPHIETIEGRVSAEQILCGRGLVNLYNAICVVDGIQPTMKDPADITSHALDGSDKV
AVETVSLFATYLGRVAGDMAMVFMARGGVYLSGGISQKIIPALKKPEFRQAFEDKAPHSA
LLRTIPTYVVTHPLAALAGLSSYARMPANFGVSTEGRRWRR
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaatccaaccacagcaccgctccgcttcccttcccgatcctgatcggcgatatc
ggcggcaccaatgcccgcttctccatcctgaccgatgcctatgccgaaccgaaacagttt
ccgaacgtgcgcacggcggatttcgccacgatcgacgaggcgatccaaaagggcgtgctc
gacaagacggcggtgcagccgcgctcggcgatcctcgccgtcgccggcccgatcaacgac
gatgagatccccctgaccaattgcgcctgggtggtgcggcccaagacgatgatcgagggc
ctcggtatcgaggatgtgctcgtcgtcaacgatttcgaggcgcaggcactagcgattgcc
gccctgtcggatgaaaaccgcgaacgcatcggcagcgccaccggcgacatggttgcctcg
cgcgtcgtgctcggacccggcaccggcctcggcgtcggcgggcttgtgcatgcccagcat
acttggatcccggttcccggcgaaggcggccatatcgatctcgggccgcgcagcaagcgc
gattatgagatatttccgcatatcgagacgatcgaaggtcgtgtttcggccgagcagatc
ctctgcggacgcggcctcgtcaatctctataacgccatctgcgtggtcgacggtatccag
ccgacgatgaaggatccggccgacatcacatcgcacgcgcttgatggcagcgacaaggtc
gccgtcgagaccgtttcgctgtttgccacctatctcggccgcgtggcgggcgacatggcg
atggtgttcatggcgcgcggcggcgtctatctctccggcggcatctcgcagaagatcatc
cccgcgctgaagaagccggaattccggcaggctttcgaggacaaggcgccgcatagcgcg
ctgcttcgcaccatcccgacctatgtggtgacgcatccgctggcggcgctcgcagggctt
tcctcctatgcgcgcatgccggccaatttcggcgtatcgacggaaggccgccgctggcgg
cgctga

DBGET integrated database retrieval system