KEGG   Rhizobium etli CFN 42: RHE_CH00228Help
Entry
RHE_CH00228       CDS       T00317                                 

Gene name
egl
Definition
endoglucanase precursor
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ret  Rhizobium etli CFN 42
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ret00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(243183..244232)
Genome map
AA seq 349 aa AA seqDB search
MGTTRHLVALLLAAALMPSPVFAAGAPCYRGVNLSGGEYGERGAIYATNYIYPSEQTIRY
FAEKGMSIIRLPFRWERLQPALGGRLDEDEFKRIKDTVGLIRKQGMAVLLDPHNFGYYDE
AQVGTAPATDAAFADFWARLAVEFANQDGVLFGLMNEPHDIKATDWLDAANAAIRAIRAV
GARNLILVPGTAWSGAHSWEEDVIGGANGTVMLGVRDPLDFYAYEVHQYLDVDSSGTHAS
CEGAAAAVEALAGVTSWLKRNHKRGFLGEFGGSADKDCMSGLTKIYAIMSGNSDVWLGWS
YWAAGEWWPADEAFNVQPYKGTERPQMQLLAASAKADAGACTAVKTAGN
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggggacgacacgacatctggtggcgctgctgcttgcggccgccctcatgccgtcgccg
gtctttgcggccggcgcgccgtgttatcgcggcgtcaatctttccggcggcgaatatggc
gagcgcggcgccatctacgccacgaactacatctatccgagcgagcagacgatccgctat
ttcgccgaaaagggcatgtcgatcattcggcttccctttcgctgggagcggctgcagccg
gcgctcggcgggcggctggacgaagacgaattcaagcggatcaaggatacggtcggcctg
atccgaaagcagggtatggccgttctgctcgacccgcacaatttcggctattacgatgag
gcgcaggtcggcaccgccccggcaacggacgccgcattcgccgacttctgggcgagactc
gcggtcgaattcgccaatcaggacggcgttctcttcggcctgatgaacgagccgcacgac
atcaaggcgacggactggctcgatgccgccaacgcggcgatccgcgctatccgcgccgtc
ggcgctcgcaatctcatcctcgtgccgggtactgcctggagcggcgctcacagctgggag
gaggatgtgattggcggtgccaacggcacggtgatgctcggcgtgcgcgatccgctcgat
ttctatgcctatgaggtccatcaatatctcgacgtcgattcatcgggaacccatgctagc
tgcgaaggcgccgccgccgcggtcgaggccctcgccggcgtcacctcttggctgaagcgg
aaccataaacgcggttttcttggcgaattcggcggatccgccgataaggactgcatgagc
ggcctcaccaagatctacgccatcatgtccgggaatagtgacgtctggctcggctggtcc
tattgggcggcgggcgaatggtggccggcggacgaagctttcaacgttcagccatacaag
ggaaccgagcgaccgcagatgcagcttctcgccgcctcggcgaaagccgatgccggcgcc
tgcaccgccgtcaagaccgcggggaactga

DBGET integrated database retrieval system