KEGG   Rhizobium etli CFN 42: RHE_CH00426Help
Entry
RHE_CH00426       CDS       T00317                                 

Definition
fatty acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ret  Rhizobium etli CFN 42
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ret01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ret01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(441665..442603)
Genome map
AA seq 312 aa AA seqDB search
MRSISTGRMIDDSSDSVKGSVVWVPAKSIWITTMTVVAVVGGPLTFSWSAVIVFVLSTAI
TICLGHSVGMHRLLIHRSFSAPLWLEHLLVYLGTLVGMAGPFGMIYAHDIRDWAQRQRDC
HDLYAHRRSFFVDALWQMHCAVALDEPPRFVVEERARHDRFYRLLEATWMAQQIPLALLL
FSLGGLPWLVWGIAVRISVSLTGHWLVGHFAHRNGHQGWSVDDVAVQGYNLPRFGLVTFG
ESFHGNHHAFPESARLGIEPGQLDLGWHFIRLLAGLGLASAIKLPHTIVPRDGLRRVEVS
GDTGEDHPVGQR
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagcatttccaccggacgcatgatcgacgacagcagtgattccgtgaagggcagc
gtggtctgggtgcccgcaaaatcgatctggataaccaccatgaccgtggttgccgtggtg
ggcggaccactgaccttcagctggagcgctgttatcgtcttcgttctatcgaccgctatc
acgatctgccttggtcattcggtcggcatgcaccggctgctgattcaccgttccttcagc
gctccgctctggctcgagcacctgctcgtctatctcggcacgctggtcggcatggccggc
ccgttcggcatgatctacgcccacgatattcgcgactgggcgcaacggcagcgagactgc
catgacctctatgcccatcggcgatcgttcttcgtcgatgccttatggcagatgcattgc
gccgtggcgctcgacgaaccgccacgattcgtcgttgaagagcgcgcgcggcacgaccgc
ttctaccgcctcctggaggcgacgtggatggcgcagcaaattcccttggcactgctgctc
ttcagtctcggcgggctgccgtggctggtgtgggggattgccgtcaggatctcggtatcg
ctgaccggccactggctggtcggtcatttcgcccatcgcaacggccatcaaggctggagc
gtcgatgacgtcgctgtgcagggatacaatctgccgcgtttcgggctggtgaccttcggc
gagagcttccacggcaaccatcacgcctttccggaatcggcgcggctcggtatcgagccg
ggacagctggacctcggctggcatttcatccggctgctggcagggctcggccttgcttcg
gcgatcaagctcccgcacacgatcgtaccgagggatgggttgagacgcgttgaagtctcc
ggagacactggtgaggatcatcctgttggtcagcgttga

DBGET integrated database retrieval system