KEGG   Rhizobium etli CFN 42: RHE_CH00426Help
Entry
RHE_CH00426       CDS       T00317                                 

Definition
fatty acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ret  Rhizobium etli CFN 42
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    RHE_CH00426
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    RHE_CH00426
Enzymes [BR:ret01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     RHE_CH00426
Lipid biosynthesis proteins [BR:ret01004]
 Desaturase
  First
   RHE_CH00426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(441665..442603)
Genome map
AA seq 312 aa AA seqDB search
MRSISTGRMIDDSSDSVKGSVVWVPAKSIWITTMTVVAVVGGPLTFSWSAVIVFVLSTAI
TICLGHSVGMHRLLIHRSFSAPLWLEHLLVYLGTLVGMAGPFGMIYAHDIRDWAQRQRDC
HDLYAHRRSFFVDALWQMHCAVALDEPPRFVVEERARHDRFYRLLEATWMAQQIPLALLL
FSLGGLPWLVWGIAVRISVSLTGHWLVGHFAHRNGHQGWSVDDVAVQGYNLPRFGLVTFG
ESFHGNHHAFPESARLGIEPGQLDLGWHFIRLLAGLGLASAIKLPHTIVPRDGLRRVEVS
GDTGEDHPVGQR
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagcatttccaccggacgcatgatcgacgacagcagtgattccgtgaagggcagc
gtggtctgggtgcccgcaaaatcgatctggataaccaccatgaccgtggttgccgtggtg
ggcggaccactgaccttcagctggagcgctgttatcgtcttcgttctatcgaccgctatc
acgatctgccttggtcattcggtcggcatgcaccggctgctgattcaccgttccttcagc
gctccgctctggctcgagcacctgctcgtctatctcggcacgctggtcggcatggccggc
ccgttcggcatgatctacgcccacgatattcgcgactgggcgcaacggcagcgagactgc
catgacctctatgcccatcggcgatcgttcttcgtcgatgccttatggcagatgcattgc
gccgtggcgctcgacgaaccgccacgattcgtcgttgaagagcgcgcgcggcacgaccgc
ttctaccgcctcctggaggcgacgtggatggcgcagcaaattcccttggcactgctgctc
ttcagtctcggcgggctgccgtggctggtgtgggggattgccgtcaggatctcggtatcg
ctgaccggccactggctggtcggtcatttcgcccatcgcaacggccatcaaggctggagc
gtcgatgacgtcgctgtgcagggatacaatctgccgcgtttcgggctggtgaccttcggc
gagagcttccacggcaaccatcacgcctttccggaatcggcgcggctcggtatcgagccg
ggacagctggacctcggctggcatttcatccggctgctggcagggctcggccttgcttcg
gcgatcaagctcccgcacacgatcgtaccgagggatgggttgagacgcgttgaagtctcc
ggagacactggtgaggatcatcctgttggtcagcgttga

DBGET integrated database retrieval system