KEGG   Rhizobium etli CFN 42: RHE_CH00559Help
Entry
RHE_CH00559       CDS       T00317                                 

Gene name
fadB2
Definition
enoyl-CoA hydratase (EC:5.1.2.3 1.1.1.35 4.2.1.17)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ret  Rhizobium etli CFN 42
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RHE_CH00559 (fadB2)
   01212 Fatty acid metabolism
    RHE_CH00559 (fadB2)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RHE_CH00559 (fadB2)
   00650 Butanoate metabolism
    RHE_CH00559 (fadB2)
  Lipid metabolism
   00071 Fatty acid degradation
    RHE_CH00559 (fadB2)
   01040 Biosynthesis of unsaturated fatty acids
    RHE_CH00559 (fadB2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RHE_CH00559 (fadB2)
   00310 Lysine degradation
    RHE_CH00559 (fadB2)
   00380 Tryptophan metabolism
    RHE_CH00559 (fadB2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RHE_CH00559 (fadB2)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RHE_CH00559 (fadB2)
   00281 Geraniol degradation
    RHE_CH00559 (fadB2)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    RHE_CH00559 (fadB2)
Enzymes [BR:ret01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     RHE_CH00559 (fadB2)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RHE_CH00559 (fadB2)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     RHE_CH00559 (fadB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
579893..582109
Genome map
AA seq 738 aa AA seqDB search
MSTYTNFTLETDADGIALVTWDMPGKSMNVFTAEVMEELNAIIDATTADASVKGVVFTSG
KSSFSGGADLSMIKSMFSSYQEEKAKSPEKAVQTLFGLVGRMSGLFRKLETSGKPWVSAI
NGTCMGGAFELSLACHGRVASNAKSVKIALPEVKVGIFPGAGGTQRVPRLANAQDALQMM
TTGQSLSGSRAKAMNLVHQVVEPDQLIPAAKQMIKDGLKPVAPWDEKGFKLPGGGIWTPA
SAQLWPAAPAILRRETSGNYPAALAILKCVYEGLQVPFDTGLKIEQRYFTEVLQTREAFS
MIRSLFISMQELGKGARRPAGIPKTELKHVGVVGAGFMGASIAYVTAAAGISVTLIDRDM
EAAAKGKAVSEGLVKDAIGKGRLTQDEAAALLSRITPSGDYADLANVGLVIEAVFEDREV
KKAVIDAVEAVLPEGAIFASNTSTLPITGLARNSKRPADFIGIHFFSPVEKMMLTEVILG
TETGDRALAVALDYVAAIKKTPIVVNDTRGFFVNRCVLRYMSESYDMLIEGVPPAMIENA
AKMAGMPVGPLALNDEVAIDLSLKILKAAVADLGEKAIDPRHMELISRMVEKEGRFGRKN
SKGFYDYPPKPAKKSLWPDLKSFYPQKKAEEVDVNVLKQRFLVTIALEAARTVEEGIVTD
PREADVGSILGFGFAPYTGGALSYIDGMGAKAFVDLAERLAETYGDHFKPTPLLRDLAAK
GETFYGRFDPYAGTKAAA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgagcacctacaccaatttcacgctcgaaaccgacgctgatggcatcgctctcgtcacc
tgggacatgcccggcaaatcgatgaacgttttcaccgccgaggtgatggaagagctcaat
gcgatcatcgacgccaccaccgctgacgccagcgtcaagggtgtcgtcttcacatcgggc
aaatcctccttctccggcggcgccgatctttcgatgatcaagtcgatgttcagctcctat
caggaggagaaggccaagagcccggaaaaggcggtacagacgctctttggtctggttggc
cgaatgagcggcctgttccgcaagctcgaaacctcgggcaagccctgggtttccgccatc
aatggcacctgcatgggcggcgcattcgaactgtcgctcgcctgccacggccgcgtcgcc
tccaatgccaagagcgtcaagatcgcgctgcccgaggtcaaggtcggcatcttccccggc
gccggcggcacccagcgtgtgccgcggctggcgaacgcccaggacgcgctgcagatgatg
acgacgggtcagtcgctgagcggctcgcgcgccaaggcgatgaacctcgtgcatcaggtg
gtcgagccggatcagctgatcccggccgccaagcagatgatcaaggacgggctgaagccg
gtggccccctgggacgagaagggcttcaagctgccgggcggcggcatctggacgccggcc
tcggcccaactctggccagccgcaccggcaatcctgcgccgcgaaacctcgggcaattat
ccggccgcgctcgccatcctgaaatgcgtctatgaaggcctgcaggtgccgttcgacacg
ggtctcaagatcgagcagcgttatttcaccgaggtgctgcagacccgcgaagccttctcg
atgatccgttcgctgttcatctccatgcaggagctcggcaagggcgcccgccgccccgcc
ggcattccgaagacggagctcaagcatgtcggcgtcgtcggcgccggcttcatgggcgcc
tcgatcgcctatgtcacggcagctgccggcatttcggtgacgttgatcgaccgtgacatg
gaagcggctgccaagggcaaggccgtttccgaaggcctcgtcaaggatgcaatcggtaag
ggacgccttactcaagatgaggcggcagcccttctctcccgcatcacgccatcgggcgat
tatgccgatctcgccaatgtcggcctcgttatcgaggccgtgttcgaggatcgcgaggta
aagaaggcggttatcgacgctgttgaagcggtgctgccggaaggcgcgatcttcgcctcc
aacacgtcgacgctgccgatcacggggctggcaaggaattccaaacgcccggccgatttc
atcggcatccacttcttctcgcccgtcgaaaagatgatgctgaccgaggtcatcctcggc
acggagaccggcgacagggcgttggcggtcgctctcgactatgtcgcggcgatcaagaag
acgccgatcgtggtcaacgacacgcgcggtttcttcgtcaatcgctgcgtgctgcgctac
atgtcggaaagctacgacatgctgatcgaaggcgtgccgcctgccatgatcgaaaatgct
gccaagatggccggcatgccggtcggtccgctggcgctcaacgacgaggtcgccatcgac
ctctcgcttaagatcctcaaagccgccgtcgccgatctcggcgagaaggccatcgacccc
aggcatatggagcttatctcccgcatggtggagaaggagggccgcttcggccgcaagaat
tccaaaggcttctatgactaccccccgaaaccggccaagaaatccctctggcccgatctc
aagagcttctatccgcagaagaaggcggaggaggtcgacgttaacgtgctgaagcagcgt
ttcctcgtcaccatcgcgctcgaagccgcccgcaccgtggaagaaggcatcgtcaccgat
ccgcgcgaagccgacgtcggctcgatcctcggcttcggcttcgcgccctataccgggggt
gcgctgagctatatcgatggcatgggcgcgaaggctttcgtggatctggctgaaaggttg
gcggaaacttacggagatcacttcaagccgacgccgctgctgagggatctggctgccaag
ggcgagacgttctacgggcggttcgatccctatgcggggacgaaggccgcggcgtaa

DBGET integrated database retrieval system